1HH4: Ras-related C3 botulinum toxin substrate 1

Rac1-RhoGDI complex involved in NADPH oxidase activation. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 Aug 2001.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 5,908
Mol. weight: 90.73 kDa
Ligands: GER, MG, GDP
Released: 28 Aug 2001

Explore 1HH4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HH4 contains 35 α-helices and 37 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	5-10	6	1
α-helix	16-24	9
α-helix	37-39	3
β-strand	40-45	6	1
β-strand	50-57	8	1
α-helix	62-64	3
α-helix	68-71	4
β-strand	77-83	7	1
α-helix	87-92	6
α-helix	93-97	5
α-helix	98-104	7
β-strand	110-115	6	1
α-helix	117-119	3
α-helix	125-128	4
α-helix	136-138	3
α-helix	139-149	11
β-strand	153-156	4	1
β-strand	158	1	2
β-strand	163	1	2
α-helix	165-176	12
α-helix	180-182	3

Chain B: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	3
α-helix	16-24	9
β-strand	42-45	4	3
β-strand	50-57	8	3
α-helix	68-71	4
β-strand	77-83	7	3
α-helix	87-92	6
α-helix	93-97	5
α-helix	98-104	7
β-strand	110-115	6	3
α-helix	117-119	3
α-helix	125-128	4
α-helix	130-132	3
α-helix	136-138	3
α-helix	139-149	11
β-strand	153-156	4	3
β-strand	158	1	4
β-strand	163	1	4
α-helix	165-176	12

Chain D: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	328-331	4
α-helix	335-339	5
α-helix	346-356	11
β-strand	370-379	10	5
β-strand	387-389	3	5
α-helix	395-398	4
β-strand	401-404	4	6
β-strand	409-418	10	5
β-strand	423-433	11	6
β-strand	438-449	12	6
β-strand	456-459	4	5
α-helix	460-462	3
β-strand	463-464	2	5
β-strand	474-482	9	6
β-strand	490-498	9	6

Chain E: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	329-331	3
α-helix	335-339	5
α-helix	346-356	11
β-strand	370-379	10	7
β-strand	386-389	4	7
α-helix	395-398	4
β-strand	401-405	5	8
β-strand	409-418	10	7
β-strand	423-433	11	8
β-strand	438-449	12	8
β-strand	456-459	4	7
α-helix	460-462	3
β-strand	463-464	2	7
α-helix	468-471	4
β-strand	474-482	9	8
β-strand	490-499	10	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related C3 botulinum toxin substrate 1	A, B	protein	192	HOMO SAPIENS	P63000 (AlphaFold model)
Rho GDP-dissociation inhibitor 1	D, E	protein	204	HOMO SAPIENS	P52565 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1HH4_1 RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1 (chains A, B)
PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVSLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL

Sequence of entity 2 (D, E), FASTA

>1HH4_2 RHO GDP-DISSOCIATION INHIBITOR 1 (chains D, E)
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSR
FTDDDKTDHLSWEWNLTIKKDWKD

Ligands and cofactors

ID	Name	Formula	Copies
GER	Geran-8-yl geran	C20 H34	2
MG	Magnesium ion	Mg	2
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2

Primary citation

Crystal Structure of the Rac1-Rhogdi Complex Involved in Nadph Oxidase Activation. Grizot, S., Faure, J., Fieschi, F. et al. Biochemistry (2001) 40:10007. DOI 10.1021/BI010288K · PubMed

Other PDB entries of the same protein (UniProt P63000 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RFF 1.25 Å, Crystal Structure of Human Rac1 Fused with the Scaffold Protein POSH (residues 319-371)
9IFK 1.34 Å, Crystal structure of Kalirin/Rac1 in complex with DK-2
1MH1 1.38 Å, Small G-protein
9HU8 1.48 Å, Crystal structure of Kalirin/Rac1 in complex with MC-278.
2WKQ 1.6 Å, Structure of a photoactivatable Rac1 containing the Lov2 C450A Mutant
6X1G 1.6 Å, Crystal structure of a GEF domain from the Orientia tsutsugamushi protein OtDUB in…
5O33 1.64 Å, A structure of the GEF Kalirin DH1 domain in complex with the small GTPase Rac1
9IG1 1.65 Å, Crystal structure of Kalirin/Rac1 in complex with DK-652
9I1L 1.68 Å, Crystal structure of Kalirin/Rac1 in complex with RS-009
8I5V 1.73 Å, DOCK10 mutant L1903Y complexed with Rac1
1RYF 1.75 Å, Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
1RYH 1.75 Å, Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase

Browse structure collections

About this viewer

MolViewer shows 1HH4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.