1HHV: Virus chemokine vmip-II

Solution structure of virus chemokine vmip-II. Determined by solution NMR. Released 16 Sept 2003.

Method: Solution NMR
Chains: 1
Atoms: 587
Mol. weight: 8.46 kDa
Released: 16 Sept 2003

Explore 1HHV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HHV contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	30-33	4	1
β-strand	43-46	4	1
β-strand	52-55	4	1
α-helix	60-68	9
β-strand	71	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Virus chemokine vmip-II	A	protein	74		Q98157 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HHV_1 VIRUS CHEMOKINE VMIP-II (chains A)
GDTLGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKD
WVKKLMQQLPVTAR

Primary citation

CCR2 and CCR5 receptor-binding properties of herpesvirus-8 vMIP-II based on sequence analysis and its solution structure. Shao, W., Fernandez, E., Sachpatzidis, A. et al. Eur J Biochem (2001) 268:2948-2959. DOI 10.1046/j.1432-1327.2001.02184.x · PubMed

Other PDB entries of the same protein (UniProt Q98157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FHT 1.7 Å, Crystal Structure of Viral Macrophage Inflammatory Protein-II
1CM9 2.1 Å, Crystal structure of viral macrophage inflammatory protein-II
2FJ2 2.3 Å, Crystal Structure of Viral Macrophage Inflammatory Protein-II
4RWS 3.1 Å, Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community…
1HFF NMR solution structures of the vMIP-II 1-10 peptide from Kaposi's sarcoma-associated…
1HFG NMR solution structure of vMIP-II 1-71 from Kaposi's sarcoma-associated herpesvirus…
1HFN NMR solution structures of vMIP-II 1-71 from Kaposi's sarcoma-associated herpesvirus.
1VMP Structure of the anti-HIV chemokine vmip-II

Browse structure collections

About this viewer

MolViewer shows 1HHV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.