1HIG: Recombinant human interferon-gamma

Three-dimensional structure of recombinant human interferon-gamma. Determined by X-ray diffraction at 3.5 Å resolution. Released 15 Apr 1992.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 492
Mol. weight: 64.82 kDa
Released: 15 Apr 1992

Explore 1HIG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HIG contains 24 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	4-15	12
α-helix	30-34	5
α-helix	34-96	63
α-helix	39-60	22
α-helix	67-82	16
α-helix	103-119	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-gamma	A, B, C, D	protein	138	Homo sapiens	P01579 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1HIG_1 INTERFERON-GAMMA (chains A, B, C, D)
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNF
KDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAEL
SPAAKTGKRKRSQMLFRG

Primary citation

Three-dimensional structure of recombinant human interferon-gamma. Ealick, S.E., Cook, W.J., Vijay-Kumar, S. et al. Science (1991) 252:698-702. PubMed

Other PDB entries of the same protein (UniProt P01579 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FYH 2.04 Å, 1:1 complex between an interferon gamma single-chain variant and its receptor
3BES 2.2 Å, Structure of a Poxvirus ifngbp/ifng Complex
1EKU 2.9 Å, Crystal structure of a biologically active single chain mutant of human ifn-gamma
1FG9 2.9 Å, 3:1 complex of interferon-gamma receptor with interferon-gamma dimer
9VNP 3.02 Å, The complexes of IFN-gamma and A01BM-03 Fab
6E3K 3.25 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2
6E3L 3.8 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2

Browse structure collections

About this viewer

MolViewer shows 1HIG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.