1HIJ: Interleukin-4

Interleukin-4 mutant with arg 88 replaced with gln (R88Q). Determined by X-ray diffraction at 3.0 Å resolution. Released 29 Jan 1996.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,067
Mol. weight: 14.96 kDa
Released: 29 Jan 1996

Explore 1HIJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HIJ contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
β-strand	28-30	3	1
α-helix	32-34	3
α-helix	41-59	19
α-helix	63-66	4
α-helix	70-94	25
β-strand	106-108	3	1
α-helix	109-128	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-4	A	protein	129	Homo sapiens	P05112 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HIJ_1 INTERLEUKIN-4 (chains A)
HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHE
KDTRCLGATAQQFHRHKQLIRFLKRLDQNLWGLAGLNSCPVKEANQSTLENFLERLKTIM
REKYSKCSS

Primary citation

Human interleukin-4 and variant R88Q: phasing X-ray diffraction data by molecular replacement using X-ray and nuclear magnetic resonance models. Muller, T., Oehlenschlager, F., Buehner, M. J Mol Biol (1995) 247:360-372. DOI 10.1006/jmbi.1994.0144 · PubMed

Other PDB entries of the same protein (UniProt P05112 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2D48 1.65 Å, Crystal structure of the Interleukin-4 variant T13D
2B8X 1.7 Å, Crystal structure of the interleukin-4 variant F82D
2B8U 1.8 Å, Crystal structure of wildtype human Interleukin-4
2B8Y 1.8 Å, Crystal structure of the interleukin-4 variant T13DF82D
2B91 2.0 Å, Crystal structure of the interleukin-4 variant F82DR85A
4YDY 2.0 Å, Crystal structure of darpin 44C12V5 in complex with human il-4
1HZI 2.05 Å, Interleukin-4 mutant E9A
2B90 2.1 Å, Crystal structure of the interleukin-4 variant T13DR85A
1RCB 2.25 Å, Crystal structure of human recombinant interleukin-4 at 2.25 Å resolution
1IAR 2.3 Å, Interleukin-4 / receptor alpha chain complex
2INT 2.35 Å, Crystal structure of recombinant human interleukin-4
2B8Z 2.5 Å, Crystal structure of the interleukin-4 variant R85A

Browse structure collections

About this viewer

MolViewer shows 1HIJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.