1HKX: Calcium/calmodulin-dependent protein kinase

Crystal structure of calcium/calmodulin-dependent protein kinase. Determined by X-ray diffraction at 2.65 Å resolution. Released 2 Jun 2003.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: MUS MUSCULUS
Chains: 14
Atoms: 15,690
Mol. weight: 239.04 kDa
Ligands: TBR, DTT
Released: 2 Jun 2003

Explore 1HKX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HKX contains 72 α-helices and 85 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	341-362	22
α-helix	366-372	7
β-strand	373-380	8	1
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	1
α-helix	393-400	8
α-helix	404-406	3
β-strand	410-421	12	1
β-strand	426-437	12	1
β-strand	445-458	14	1
β-strand	461-470	10	1

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	342-362	21
α-helix	366-372	7
β-strand	373-380	8	2
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	2
α-helix	403-405	3
β-strand	411-421	11	2
β-strand	426-437	12	2
β-strand	445-458	14	2
β-strand	461-471	11	2

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	342-362	21
α-helix	366-372	7
β-strand	373-380	8	3
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	3
β-strand	410-421	12	3
β-strand	426-437	12	3
β-strand	445-458	14	3
β-strand	461-470	10	3

Chains D, F and N: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	342-362	21
α-helix	366-372	7
β-strand	373-380	8	4
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	4
α-helix	393-400	8
β-strand	411-421	11	4
β-strand	426-437	12	4
β-strand	445-458	14	4
β-strand	461-470	10	4

Chain E: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	342-362	21
α-helix	366-372	7
β-strand	373-380	8	5
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	5
α-helix	393-400	8
β-strand	410-421	12	5
β-strand	426-437	12	5
β-strand	445-458	14	5
β-strand	461-470	10	5

Chain G: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	342-362	21
α-helix	366-372	7
β-strand	373-380	8	7
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	7
α-helix	396-400	5
α-helix	403-405	3
β-strand	411-421	11	7
β-strand	426-437	12	7
β-strand	445-458	14	7
β-strand	461-471	11	7

Chain H: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	340-362	23
α-helix	366-372	7
β-strand	373-380	8	8
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	8
α-helix	393-400	8
α-helix	403-406	4
β-strand	411-421	11	8
β-strand	426-437	12	8
β-strand	445-458	14	8
β-strand	461-471	11	8

Chain I: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	343-362	20
α-helix	366-372	7
β-strand	373-380	8	9
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	9
α-helix	395-397	3
β-strand	411-421	11	9
β-strand	426-437	12	9
β-strand	445-458	14	9
β-strand	461-470	10	9

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase type II alpha chain	A, B, C, D, E, F, G, H, I, J, K, L, M, N	protein	147	MUS MUSCULUS	P11798 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N), FASTA

>1HKX_1 CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE II ALPHA CHAIN (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N)
GPHMTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEG
LDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEE
TRVWHRRDGKWQIVHFHRSGAPSVLPH

Ligands and cofactors

ID	Name	Formula	Copies
TBR	Hexatantalum dodecabromide	Br12 Ta6	1
DTT	2,3-dihydroxy-1,4-dithiobutane	C4 H10 O2 S2	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal Structure of a Tetradecameric Assembly of the Association Domain of Ca2+/Calmodulin-Dependent Kinase II. Hoelz, A., Nairn, A.C., Kuriyan, J. Mol Cell (2003) 11:1241. DOI 10.1016/S1097-2765(03)00171-0 · PubMed

Other PDB entries of the same protein (UniProt P11798 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TS3 1.28 Å, EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
7B55 1.6 Å, Crystal structure of CaMKII-actinin complex bound to MES
4X3I 1.8 Å, The crystal structure of Arc N-lobe complexed with CAMK2A fragment
7B57 1.95 Å, Crystal structure of CaMKII-actinin complex bound to ADP

Browse structure collections

About this viewer

MolViewer shows 1HKX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.