6TS3: EF-hands 3 and 4 of alpha-actinin

EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment. Determined by X-ray diffraction at 1.28 Å resolution. Released 13 Jan 2021.

Method: X-ray diffraction
Resolution: 1.28 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 1,668
Mol. weight: 20.75 kDa
Ligands: ACE
Released: 13 Jan 2021

Explore 6TS3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TS3 contains 14 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	823-838	16
β-strand	845	1	1
α-helix	847-853	7
α-helix	856-865	10
α-helix	867	1
β-strand	868	1	1
α-helix	869	1
β-strand	879	1	1
α-helix	881-889	9

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	295-309	15

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	295-307	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-actinin-2	A, B	protein	73	Homo sapiens	P35609 (AlphaFold model)
Ace-asn-ala-arg-arg-lys-leu-lys-gly-ala-ile-leu-thr-thr-met-leu-ala-thr-arg-asn-phe	C, D	protein	22	Mus musculus	P11798 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6TS3_1 Alpha-actinin-2 (chains A, B)
SNATDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDY
AAFSSALYGESDL

Sequence of entity 2 (C, D), FASTA

>6TS3_2 ACE-ASN-ALA-ARG-ARG-LYS-LEU-LYS-GLY-ALA-ILE-LEU-THR-THR-MET-LEU-ALA-THR-ARG-ASN-PHE (chains C, D)
NARRKLKGAILTTMLATRNFSG

Ligands and cofactors

ID	Name	Formula	Copies
ACE	Acetyl group	C2 H4 O	2

Primary citation

EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment. Zhu, J., Gold, M. To be published.

Other PDB entries of the same protein (UniProt P35609 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SWT 1.2 Å, Affimer9 co-crystalised with the CH domains of alpha actinin 2.
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
7B55 1.6 Å, Crystal structure of CaMKII-actinin complex bound to MES
5A37 1.88 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A38 1.9 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
7B57 1.95 Å, Crystal structure of CaMKII-actinin complex bound to ADP
5A36 2.0 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A4B 2.01 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
1QUU 2.5 Å, Crystal structure of two central spectrin-like repeats from alpha-actinin
7A8T 2.69 Å, Crystal structure of sarcomeric protein FATZ-1 (mini-FATZ-1 construct) in complex with…
1HCI 2.8 Å, Crystal structure of the rod domain of alpha-actinin
7ANK 3.2 Å, Crystal structure of sarcomeric protein FATZ-1 (d91-FATZ-1 construct) in complex with…

Browse structure collections

About this viewer

MolViewer shows 6TS3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.