7B55: CaMKII-actinin complex

Crystal structure of CaMKII-actinin complex bound to MES. Determined by X-ray diffraction at 1.6 Å resolution. Released 22 Jun 2022.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 3,334
Mol. weight: 44.2 kDa
Released: 22 Jun 2022

Explore 7B55 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7B55 contains 24 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	828-838	11
β-strand	845	1	5
α-helix	847-853	7
α-helix	856-865	10
α-helix	866-867	2
β-strand	868	1	5
α-helix	869	1
β-strand	879	1	5
α-helix	881-888	8

Chain B: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-12	5
β-strand	13-21	9	1
β-strand	25-32	8	1
β-strand	37-45	9	1
α-helix	51-66	16
β-strand	72	1	2
β-strand	75-80	6	1
β-strand	84-90	7	1
α-helix	91-92	2
β-strand	96	1	2
α-helix	97-104	8
α-helix	109-128	20
β-strand	131-132	2	3
α-helix	138-140	3
β-strand	141-143	3	2
α-helix	150-151	2
β-strand	152-154	3	2
β-strand	161-162	2	3
β-strand	169	1	4
α-helix	177-179	3
α-helix	182-185	4
β-strand	190	1	4
α-helix	193-208	16
α-helix	218-226	9
α-helix	236-239	4
α-helix	242-251	10
α-helix	260-261	2
α-helix	262-266	5
α-helix	269-272	4
α-helix	274-277	4
α-helix	284-311	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase type II subunit alpha	B	protein	317	Mus musculus	P11798 (AlphaFold model)
Alpha-actinin-2	A	protein	73	Homo sapiens	P35609 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7B55_1 Calcium/calmodulin-dependent protein kinase type II subunit alpha (chains B)
SMMATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLE
REARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQ
ILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPG
YLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWD
TVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRK
LKGAILAAMLATRNFSG

Sequence of entity 2 (A), FASTA

>7B55_2 Alpha-actinin-2 (chains A)
SNATDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDY
AAFSSALYGESDL

Primary citation

Crystal structure of CaMKII-actinin complex bound to MES. Zhu, J., Gold, M. To be published.

Other PDB entries of the same protein (UniProt P11798 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TS3 1.28 Å, EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
4X3I 1.8 Å, The crystal structure of Arc N-lobe complexed with CAMK2A fragment
7B57 1.95 Å, Crystal structure of CaMKII-actinin complex bound to ADP
1HKX 2.65 Å, Crystal structure of calcium/calmodulin-dependent protein kinase

Browse structure collections

About this viewer

MolViewer shows 7B55 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.