7B57: CaMKII-actinin complex

Crystal structure of CaMKII-actinin complex bound to ADP. Determined by X-ray diffraction at 1.95 Å resolution. Released 22 Jun 2022.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 3,227
Mol. weight: 44.45 kDa
Ligands: ADP, MG
Released: 22 Jun 2022

Explore 7B57 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7B57 contains 22 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	828-838	11
β-strand	845	1	5
α-helix	847-853	7
α-helix	856-863	8
β-strand	879	1	5
α-helix	881-886	6

Chain B: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-12	5
β-strand	13-21	9	1
β-strand	26-32	7	1
β-strand	37-45	9	1
α-helix	51-66	16
β-strand	72	1	2
α-helix	73-74	2
β-strand	75-80	6	1
β-strand	84-90	7	1
β-strand	96	1	2
α-helix	97-103	7
α-helix	109-128	20
β-strand	131-132	2	3
α-helix	138-140	3
β-strand	141-143	3	2
α-helix	150-151	2
β-strand	152-154	3	2
β-strand	161-162	2	3
β-strand	169	1	4
α-helix	177-179	3
α-helix	182-185	4
β-strand	190	1	4
α-helix	193-208	16
α-helix	218-226	9
α-helix	236-239	4
α-helix	242-251	10
α-helix	260-261	2
α-helix	262-266	5
α-helix	269-272	4
α-helix	274-277	4
α-helix	284-306	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase type II subunit alpha	B	protein	317	Mus musculus	P11798 (AlphaFold model)
Alpha-actinin-2	A	protein	73	Homo sapiens	P35609 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7B57_1 Calcium/calmodulin-dependent protein kinase type II subunit alpha (chains B)
SMMATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLE
REARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQ
ILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPG
YLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWD
TVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRK
LKGAILAAMLATRNFSG

Sequence of entity 2 (A), FASTA

>7B57_2 Alpha-actinin-2 (chains A)
SNATDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDY
AAFSSALYGESDL

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (MES) are not listed.

Primary citation

Crystal structure of CaMKII-actinin complex bound to ADP. Zhu, J., Gold, M. To be published.

Other PDB entries of the same protein (UniProt P11798 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TS3 1.28 Å, EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
7B55 1.6 Å, Crystal structure of CaMKII-actinin complex bound to MES
4X3I 1.8 Å, The crystal structure of Arc N-lobe complexed with CAMK2A fragment
1HKX 2.65 Å, Crystal structure of calcium/calmodulin-dependent protein kinase

Browse structure collections

About this viewer

MolViewer shows 7B57 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.