1HLL: Alpha-2A adrenergic receptor
NMR structure of T3-I2, a 32 residue peptide from the alpha-2A adrenergic receptor. Determined by solution NMR. Released 10 Apr 2002.
- Method
- Solution NMR
- Chains
- 1
- Atoms
- 266
- Mol. weight
- 3.8 kDa
- Released
- 10 Apr 2002
Explore 1HLL in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1HLL contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| α-helix | 13-22 | 10 | |
| α-helix | 23-25 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Alpha-2A adrenergic receptor | A | protein | 32 | | P08913 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>1HLL_1 ALPHA-2A ADRENERGIC RECEPTOR (chains A)
TSSIVHLCAISLDRYWSITQAIEYNLKRTPRR
Primary citation
NMR structure of the second intracellular loop of the alpha 2A adrenergic receptor: evidence for a novel cytoplasmic helix. Chung, D.A., Zuiderweg, E.R., Fowler, C.B. et al. Biochemistry (2002) 41:3596-3604. DOI 10.1021/bi015811+ · PubMed
Other PDB entries of the same protein (UniProt P08913 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6KUX 2.7 Å, Crystal structures of the alpha2A adrenergic receptor in complex with an antagonist RSC.
- 9CBL 2.8 Å, Cryo-EM structure of epinephrine-bound alpha-2A-adrenergic receptor in complex with…
- 9PLN 2.8 Å, Locally-refined structure of alpha2a adrenergic receptor in complex with Go…
- 9PLO 2.8 Å, Structure of alpha2a adrenergic receptor in complex with Go heterotrimer, scFv16, and…
- 7EJ8 3.0 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to brimonidine
- 6KUY 3.2 Å, Crystal structure of the alpha2A adrenergic receptor in complex with a partial agonist
- 7EJ0 3.2 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex
- 9CBM 3.2 Å, Cryo-EM structure of dexmedetomidine-bound alpha-2A-adrenergic receptor in complex with…
- 9PQD 3.29 Å, Locally-refined structure of alpha2a adrenergic receptor in complex with Go…
- 7EJK 3.4 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to oxymetazoline
- 7W7E 3.4 Å, Cryo-EM structure of the alpha2A adrenergic receptor GoA signaling complex bound to a…
- 9IQR 3.4 Å, Cryo-EM structure of MT3-alpha2AAR
Browse structure collections
About this viewer
MolViewer shows 1HLL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.