1HO8: Vacuolar ATP synthase subunit H

Crystal structure of the regulatory subunit H of the V-type atpase of saccharomyces cerevisiae. Determined by X-ray diffraction at 2.95 Å resolution. Released 20 Jun 2001.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 3,638
Mol. weight: 54.72 kDa
Released: 20 Jun 2001

Explore 1HO8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HO8 contains 30 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 0 β-strands

Element	Residues	Length
α-helix	11-22	12
α-helix	27-32	6
α-helix	38-52	15
α-helix	77-85	9
α-helix	90-105	16
α-helix	111-119	9
α-helix	123-130	8
α-helix	136-150	15
α-helix	158-166	9
α-helix	168-175	8
α-helix	180-194	15
α-helix	197-204	8
α-helix	207-222	16
α-helix	239-253	15
α-helix	257-264	8
α-helix	268-280	13
α-helix	284-296	13
α-helix	305-316	12
α-helix	318-326	9
α-helix	333-351	19
α-helix	355-365	11
α-helix	372-375	4
α-helix	377-383	7
α-helix	385-387	3
α-helix	390-392	3
α-helix	393-407	15
α-helix	414-433	20
α-helix	437-444	8
α-helix	446-453	8
α-helix	459-475	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar ATP synthase subunit H	A	protein	480	Saccharomyces cerevisiae	P41807 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HO8_1 VACUOLAR ATP SYNTHASE SUBUNIT H (chains A)
GSMGATKILMDSTHFNEIRSIIRSRSVAWDALARSEELSEIDASTAKALESILVKKNIGD
GLSSSNNAHSGFKVNGKTLIPLIHLLSTSDNEDCKKSVQNLIAELLSSDKYGDDTVKFFQ
EDPKQLEQLFDVSLKGDFQTVLISGFNVVSLLVQNGLHNVKLVEKLLKNNNLINILQNIE
QMDTCYVCIRLLQELAVIPEYRDVIWLHEKKFMPTLFKILQRATDSQLATRIVATNSNHL
GIQLQYHSLLLIWLLTFNPVFANELVQKYLSDFLDLLKLVKITIKEKVSRLCISIILQCC
STRVKQHKKVIKQLLLLGNALPTVQSLSERKYSDEELRQDISNLKEILENEYQELTSFDE
YVAELDSKLLCWSPPHVDNGFWSDNIDEFKKDNYKIFRQLIELLQAKVRNGDVNAKQEKI
IIQVALNDITHVVELLPESIDVLDKTGGKADIMELLNHSDSRVKYEALKATQAIIGYTFK

Primary citation

Crystal structure of the regulatory subunit H of the V-type ATPase of Saccharomyces cerevisiae. Sagermann, M., Stevens, T.H., Matthews, B.W. Proc Natl Acad Sci U S A (2001) 98:7134-7139. DOI 10.1073/pnas.131192798 · PubMed

Other PDB entries of the same protein (UniProt P41807 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9COP 2.7 Å, Yeast RAVE bound to V-ATPase V1 complex
7TMO 3.3 Å, V1 complex lacking subunit C from Saccharomyces cerevisiae, State 1
7TMP 3.3 Å, V1 complex lacking subunit C from Saccharomyces cerevisiae, State 2
7TMQ 3.3 Å, V1 complex lacking subunit C from Saccharomyces cerevisiae, State 3
7TMM 3.5 Å, Complete V1 Complex from Saccharomyces cerevisiae
7TMR 3.5 Å, V-ATPase from Saccharomyces cerevisiae, State 1
9MOY 3.6 Å, Reconstituted yeast V-ATPase bound to Rtc5p
7TMS 3.8 Å, V-ATPase from Saccharomyces cerevisiae, State 2
7TMT 3.8 Å, V-ATPase from Saccharomyces cerevisiae, State 3
9ODU 3.9 Å, Yeast V-ATPase bound to Rtc5p, rotary state 2
7FDA 4.2 Å, CryoEM Structure of Reconstituted V-ATPase, state1
7FDB 4.8 Å, CryoEM Structures of Reconstituted V-ATPase,State2

Browse structure collections

About this viewer

MolViewer shows 1HO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.