1HPH: Human parathyroid hormone 1-37 in solution

Name: PDB 1HPH: Structure of human parathyroid hormone 1-37 in solution
Published: 1995-07-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hormone

Structure of human parathyroid hormone 1-37 in solution. Determined by solution NMR. Released 10 Jul 1995.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 309
Mol. weight: 4.41 kDa
Released: 10 Jul 1995

Explore 1HPH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HPH contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	17-28	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human parathyroid hormone fragment 1 - 37	A	protein	37	Homo sapiens	P01270 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HPH_1 HUMAN PARATHYROID HORMONE FRAGMENT 1 - 37 (chains A)
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL

Primary citation

Structure of human parathyroid hormone 1-37 in solution. Marx, U.C., Austermann, S., Bayer, P. et al. J Biol Chem (1995) 270:15194-15202. DOI 10.1074/jbc.270.25.15194 · PubMed

Other PDB entries of the same protein (UniProt P01270 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ET1 0.9 Å, Crystal structure of human parathyroid hormone 1-34 at 0.9 a resolution
3C4M 1.95 Å, Structure of human parathyroid hormone in complex with the extracellular domain of its…
8T5F 1.99 Å, De novo design of high-affinity protein binders to bioactive helical peptides
8FLQ 2.55 Å, Human PTH1R in complex with PTH(1-34) and Gs
8HA0 2.62 Å, Molecular recognition of two endogenous hormones by the human parathyroid hormone…
7VVL 2.8 Å, PTH-bound human PTH1R in complex with Gs (class2)
7Y36 2.8 Å, Cryo-EM structure of the Teriparatide-bound human PTH1R-Gs complex
9JR2 2.8 Å, Cryo-EM structure of PTH-PTH1R-Gq (upright state)
9JR3 2.8 Å, Cryo-EM structure of PTH-PTH1R-Gq (tilted state)
7VVM 3.2 Å, PTH-bound human PTH1R in complex with Gs (class3)
7VVK 3.3 Å, PTH-bound human PTH1R in complex with Gs (class1)
8HAO 3.76 Å, Human parathyroid hormone receptor-1 dimer

Browse structure collections

About this viewer

MolViewer shows 1HPH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.