The solution structure of cyclic human parathyroid hormone fragment 1-34, NMR, 10 structures. Determined by solution NMR. Released 15 Oct 1997.
Explore 1HTH in 3D Show helices and sheets RCSB PDB PDBe
1HTH contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 8-11 | 4 | |
| α-helix | 20-26 | 7 | |
| α-helix | 27-31 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cyclic parathyroid hormone | A | protein | 34 | Homo sapiens | P01270 (AlphaFold model) |
>1HTH_1 CYCLIC PARATHYROID HORMONE (chains A) SVSEIQLLHNLGAHLNELERVEWLRKKLQDVHNF
The structure of human parathyroid hormone-related protein(1-34) in near-physiological solution. Weidler, M., Marx, U.C., Seidel, G. et al. FEBS Lett (1999) 444:239-244. DOI 10.1016/S0014-5793(98)01658-5 · PubMed
Other PDB entries of the same protein (UniProt P01270 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1HTH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.