1HTJ: Rgs-like domain from PDZ-rhogef

Structure of the rgs-like domain from PDZ-rhogef. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Jul 2001.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,529
Mol. weight: 23.9 kDa
Released: 11 Jul 2001

Explore 1HTJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HTJ contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain F: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	307-312	6
α-helix	314-319	6
α-helix	321-334	14
α-helix	338-349	12
α-helix	356-364	9
α-helix	365-369	5
α-helix	381-392	12
α-helix	398-424	27
α-helix	428-431	4
α-helix	435-438	4
α-helix	443-462	20
α-helix	466-482	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIAA0380	F	protein	210	Homo sapiens	O15085 (AlphaFold model)

Sequence of entity 1 (F), FASTA

>1HTJ_1 KIAA0380 (chains F)
QGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPL
LFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGV
LCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDI
LSAYAADRSAPMDFALNTYMSHAGIRLREA

Primary citation

Structure of the RGS-like domain from PDZ-RhoGEF: linking heterotrimeric g protein-coupled signaling to Rho GTPases. Longenecker, K.L., Lewis, M.E., Chikumi, H. et al. Structure (2001) 9:559-569. DOI 10.1016/S0969-2126(01)00620-7 · PubMed

Other PDB entries of the same protein (UniProt O15085 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JHH 2.3 Å, Crystal structure of the ternary complex between the human RhoA, its inhibitor and the…
5TYT 2.4 Å, Crystal Structure of the PDZ domain of RhoGEF bound to CXCR2 C-terminal peptide
1XCG 2.5 Å, Crystal Structure of Human RhoA in complex with DH/PH fragment of PDZRHOGEF
5JHG 2.5 Å, Crystal structure of the complex between the human RhoA and the DH/PH domain of human…
3KZ1 2.7 Å, Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated…
3T06 2.84 Å, Crystal Structure of the DH/PH fragment of PDZRHOGEF with N-terminal regulatory elements…
5E6P 3.21 Å, PlexinB2 cytoplasmic region/PDZ-RhoGEF PDZ domain complex
2DLS Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11

Browse structure collections

About this viewer

MolViewer shows 1HTJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.