2DLS: Rho guanine nucleotide exchange factor 11

Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11. Determined by solution NMR. Released 20 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 659
Mol. weight: 9.44 kDa
Released: 20 Oct 2006

Explore 2DLS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DLS contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	9-15	7	1
β-strand	23-26	4	1
β-strand	32-36	5	1
β-strand	52-56	5	1
β-strand	59-60	2	1
α-helix	66-73	8
β-strand	78-84	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho guanine nucleotide exchange factor 11	A	protein	93	Homo sapiens	O15085 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DLS_1 Rho guanine nucleotide exchange factor 11 (chains A)
GSSGSSGVQRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTM
VTNSSHLEVVKLIKSGAYVALTLLGSSSGPSSG

Primary citation

Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11. Inoue, K., Suetake, T., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt O15085 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HTJ 2.2 Å, Structure of the rgs-like domain from PDZ-rhogef
5JHH 2.3 Å, Crystal structure of the ternary complex between the human RhoA, its inhibitor and the…
5TYT 2.4 Å, Crystal Structure of the PDZ domain of RhoGEF bound to CXCR2 C-terminal peptide
1XCG 2.5 Å, Crystal Structure of Human RhoA in complex with DH/PH fragment of PDZRHOGEF
5JHG 2.5 Å, Crystal structure of the complex between the human RhoA and the DH/PH domain of human…
3KZ1 2.7 Å, Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated…
3T06 2.84 Å, Crystal Structure of the DH/PH fragment of PDZRHOGEF with N-terminal regulatory elements…
5E6P 3.21 Å, PlexinB2 cytoplasmic region/PDZ-RhoGEF PDZ domain complex

Browse structure collections

About this viewer

MolViewer shows 2DLS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.