5JHH: Rho guanine nucleotide exchange factor 11

Crystal structure of the ternary complex between the human RhoA, its inhibitor and the DH/PH domain of human ARHGEF11. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Apr 2017.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 9,361
Mol. weight: 127.67 kDa
Ligands: RA0
Released: 26 Apr 2017

Explore 5JHH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JHH contains 55 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	730-755	26
α-helix	756-761	6
α-helix	762-766	5
α-helix	772-778	7
α-helix	782-801	20
α-helix	810-817	8
α-helix	819-833	15
α-helix	836-849	14
α-helix	851-862	12
α-helix	864-866	3
α-helix	871-874	4
α-helix	877-894	18
α-helix	901-939	39
β-strand	940-941	2	1
α-helix	951-956	6
α-helix	961-963	3
β-strand	966-975	10	2
β-strand	981-989	9	2
β-strand	992-996	5	2
β-strand	997-999	3	1
β-strand	1002-1004	3	1
β-strand	1025-1027	3	2
α-helix	1028-1030	3
β-strand	1031-1035	5	2
β-strand	1042-1047	6	2
β-strand	1055	1	3
α-helix	1056	1
β-strand	1057-1060	4	2
α-helix	1064-1080	17

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	4
α-helix	18-27	10
β-strand	42-48	7	4
β-strand	51-58	8	4
α-helix	70-73	4
β-strand	79-85	7	4
α-helix	89-94	6
α-helix	95-99	5
α-helix	100-106	7
β-strand	112-117	6	4
α-helix	119-121	3
α-helix	125-133	9
α-helix	141-151	11
β-strand	155-158	4	4
α-helix	167-179	13

Chain E: 18 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	730-755	26
α-helix	756-761	6
α-helix	762-766	5
α-helix	772-778	7
α-helix	782-801	20
α-helix	810-817	8
α-helix	819-834	16
α-helix	836-849	14
α-helix	851-862	12
α-helix	864-866	3
α-helix	871-874	4
α-helix	877-894	18
α-helix	901-939	39
β-strand	940-941	2	5
α-helix	943-945	3
α-helix	951-954	4
α-helix	961-963	3
β-strand	966-977	12	3
β-strand	980-989	10	3
β-strand	992-996	5	3
β-strand	997-999	3	5
β-strand	1002-1004	3	5
β-strand	1008	1	6
β-strand	1022	1	6
β-strand	1025-1027	3	3
α-helix	1028-1030	3
β-strand	1031-1035	5	3
β-strand	1042-1047	6	3
β-strand	1055-1060	6	3
α-helix	1064-1079	16

Chain F: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-12	9	7
α-helix	18-27	10
β-strand	42-48	7	7
β-strand	51-58	8	7
α-helix	70-73	4
β-strand	79-85	7	7
β-strand	88	1	7
α-helix	89-94	6
α-helix	95-99	5
α-helix	100-106	7
β-strand	112-117	6	7
α-helix	119-121	3
α-helix	125-132	8
α-helix	138-140	3
α-helix	141-150	10
β-strand	155-158	4	7
α-helix	167-179	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho guanine nucleotide exchange factor 11	A, E	protein	369	Homo sapiens	O15085 (AlphaFold model)
Transforming protein RhoA	B, F	protein	181	Homo sapiens	P61586 (AlphaFold model)

Sequence of entity 1 (A, E), FASTA

>5JHH_1 Rho guanine nucleotide exchange factor 11 (chains A, E)
MQNWQHTVGKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPR
EELARLFPNLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQF
CSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESI
IKHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPL
AAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTA
VGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWME
LLEEAVRNA

Sequence of entity 2 (B, F), FASTA

>5JHH_2 Transforming protein RhoA (chains B, F)
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
A

Ligands and cofactors

ID	Name	Formula	Copies
RA0	3-{3-[ethyl(quinolin-2-yl)amino]phenyl}propanoic acid	C20 H20 N2 O2	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA bound with its inhibitor and PDZRhoGEF. Wang, R., Yan, Z., Lv, Z. et al. To be published.

Other PDB entries of the same protein (UniProt O15085 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HTJ 2.2 Å, Structure of the rgs-like domain from PDZ-rhogef
5TYT 2.4 Å, Crystal Structure of the PDZ domain of RhoGEF bound to CXCR2 C-terminal peptide
1XCG 2.5 Å, Crystal Structure of Human RhoA in complex with DH/PH fragment of PDZRHOGEF
5JHG 2.5 Å, Crystal structure of the complex between the human RhoA and the DH/PH domain of human…
3KZ1 2.7 Å, Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated…
3T06 2.84 Å, Crystal Structure of the DH/PH fragment of PDZRHOGEF with N-terminal regulatory elements…
5E6P 3.21 Å, PlexinB2 cytoplasmic region/PDZ-RhoGEF PDZ domain complex
2DLS Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11

Browse structure collections

About this viewer

MolViewer shows 5JHH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.