1IBA: Glucose permease

Glucose permease (domain iib), NMR, 11 structures. Determined by solution NMR. Released 14 Oct 1996.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 564
Mol. weight: 10.75 kDa
Released: 14 Oct 1996

Explore 1IBA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IBA contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	16-19	4
α-helix	21-24	4
β-strand	31	1	1
β-strand	38-40	3	2
β-strand	42	1	1
α-helix	51-53	3
α-helix	54-58	5
β-strand	62-65	4	2
β-strand	68-72	5	2
α-helix	77-90	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucose permease	A	protein	101	Escherichia coli	P69786 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IBA_1 GLUCOSE PERMEASE (chains A)
MFKNEDAKATGTSEMAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAA
GVVVAGSGVQAIFGTKSDNLKTEMDEYIRNFGSRSHHHHHH

Primary citation

Solution structure of the IIB domain of the glucose transporter of Escherichia coli. Eberstadt, M., Grdadolnik, S.G., Gemmecker, G. et al. Biochemistry (1996) 35:11286-11292. DOI 10.1021/bi960492l · PubMed

Other PDB entries of the same protein (UniProt P69786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BP3 1.65 Å, Crystal structure of EIIB
9HNP 2.53 Å, Cryo-EM structure of the glucose-specific PTS transporter IICB from E. coli in an…
8QSR 2.56 Å, Cryo-EM structure of the glucose-specific PTS transporter IICB from E. coli in the…
3BP8 2.85 Å, Crystal structure of Mlc/EIIB complex
8QST 2.89 Å, Cryo-EM structure of the glucose-specific PTS transporter IICB from E. coli in the…
9SRX 2.96 Å, Cryo-EM structure of the Mlc repressor in complex with the glucose-specific IICB…
1O2F Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli…
9A3B Model of E. coli PtsG by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 1IBA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.