3BP3: EIIB

Crystal structure of EIIB. Determined by X-ray diffraction at 1.65 Å resolution. Released 4 Nov 2008.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,297
Mol. weight: 17.36 kDa
Released: 4 Nov 2008

Explore 3BP3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BP3 contains 12 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	13-20	8
α-helix	24-26	3
β-strand	27-32	6	1
β-strand	36-41	6	1
α-helix	44-46	3
α-helix	49-54	6
β-strand	59-63	5	1
β-strand	66-70	5	1
α-helix	72-74	3
α-helix	75-87	13

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	1
α-helix	13-20	8
α-helix	24-26	3
β-strand	27-32	6	2
β-strand	36-41	6	2
α-helix	44-46	3
α-helix	49-54	6
β-strand	59-63	5	2
β-strand	66-70	5	2
α-helix	72-74	3
α-helix	75-87	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucose-specific phosphotransferase enzyme IIB component	A, B	protein	82	Escherichia coli	P69786 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3BP3_1 Glucose-specific phosphotransferase enzyme IIB component (chains A, B)
TGTSEMAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGV
QAIFGTKSDNLKTEMDEYIRNH

Primary citation

Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Nam, T.W., Jung, H.I., An, Y.J. et al. Proc Natl Acad Sci U S A (2008) 105:3751-3756. DOI 10.1073/pnas.0709295105 · PubMed

Other PDB entries of the same protein (UniProt P69786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HNP 2.53 Å, Cryo-EM structure of the glucose-specific PTS transporter IICB from E. coli in an…
8QSR 2.56 Å, Cryo-EM structure of the glucose-specific PTS transporter IICB from E. coli in the…
3BP8 2.85 Å, Crystal structure of Mlc/EIIB complex
8QST 2.89 Å, Cryo-EM structure of the glucose-specific PTS transporter IICB from E. coli in the…
9SRX 2.96 Å, Cryo-EM structure of the Mlc repressor in complex with the glucose-specific IICB…
1IBA Glucose permease (domain iib), NMR, 11 structures
1O2F Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli…
9A3B Model of E. coli PtsG by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 3BP3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.