8QSR: PTS system glucose-specific EIICB component

Cryo-EM structure of the glucose-specific PTS transporter IICB from E. coli in the inward-facing conformation. Determined by electron microscopy at 2.56 Å resolution. Released 25 Sept 2024.

Method: Electron microscopy
Resolution: 2.56 Å
Organism: Escherichia coli
Chains: 2
Atoms: 5,808
Mol. weight: 107.24 kDa
Ligands: BGC
Released: 25 Sept 2024

Explore 8QSR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QSR contains 58 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 29 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-21	17
α-helix	23-26	4
α-helix	27-31	5
α-helix	32-35	4
α-helix	42-57	16
α-helix	59-70	12
β-strand	75	1	1
α-helix	76-101	26
α-helix	105-111	7
α-helix	118-135	18
α-helix	142-144	3
α-helix	149-151	3
α-helix	153-184	32
α-helix	185-189	5
α-helix	191-205	15
α-helix	206-208	3
α-helix	211-216	6
α-helix	217-221	5
β-strand	225-226	2	2
β-strand	232-233	2	2
α-helix	236-242	7
α-helix	249-251	3
α-helix	252-254	3
α-helix	255-260	6
α-helix	261-271	11
α-helix	274-276	3
α-helix	278-293	16
α-helix	298-301	4
α-helix	309-329	21
β-strand	332	1	3
α-helix	341-346	6
α-helix	348-350	3
β-strand	352	1	3
α-helix	356-379	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PTS system glucose-specific EIICB component	A, B	protein	499	Escherichia coli	P69786 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8QSR_1 PTS system glucose-specific EIICB component (chains A, B)
MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMP
LIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPAEEIASKHLADTGVLG
GIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQ
TFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFHGDIPRY
MAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPI
EFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLFPIV
GIGYAIVYYTIFRVLIKALDLKTPGREDATEDAKATGTSEMAPALVAAFGGKENITNLDA
CITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNHLEL
EVLFQGPVDHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
BGC	beta-D-glucopyranose	C6 H12 O6	2

Primary citation

Structure and mechanism of a phosphotransferase system glucose transporter. Roth, P., Jeckelmann, J.M., Fender, I. et al. Nat Commun (2024) 15:7992-7992. DOI 10.1038/s41467-024-52100-3 · PubMed

Other PDB entries of the same protein (UniProt P69786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BP3 1.65 Å, Crystal structure of EIIB
9HNP 2.53 Å, Cryo-EM structure of the glucose-specific PTS transporter IICB from E. coli in an…
3BP8 2.85 Å, Crystal structure of Mlc/EIIB complex
8QST 2.89 Å, Cryo-EM structure of the glucose-specific PTS transporter IICB from E. coli in the…
9SRX 2.96 Å, Cryo-EM structure of the Mlc repressor in complex with the glucose-specific IICB…
1IBA Glucose permease (domain iib), NMR, 11 structures
1O2F Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli…
9A3B Model of E. coli PtsG by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 8QSR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.