1IDI: Alpha-bungarotoxin
The NMR solution structure of alpha-bungarotoxin. Determined by solution NMR. Released 25 Apr 2001.
- Method
- Solution NMR
- Organism
- Bungarus multicinctus
- Chains
- 1
- Atoms
- 551
- Mol. weight
- 8.01 kDa
- Released
- 25 Apr 2001
Explore 1IDI in 3D
Show helices and sheets
RCSB PDB
PDBe
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Alpha-bungarotoxin | A | protein | 74 | Bungarus multicinctus | P60615 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>1IDI_1 ALPHA-BUNGAROTOXIN (chains A)
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG
Primary citation
The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica. Zeng, H., Moise, L., Grant, M.A. et al. J Biol Chem (2001) 276:22930-22940. DOI 10.1074/jbc.M102300200 · PubMed
Other PDB entries of the same protein (UniProt P60615 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9FYS 1.32 Å, D11 mAbs bound to alpha-Bungarotoxin
- 9HUB 1.33 Å, D11 mAbs bound to alpha-Bungarotoxin at pH 7.5
- 1HC9 1.8 Å, alpha-bungarotoxin complexed with high affinity peptide
- 8VY8 2.4 Å, Recombinant alpha bungarotoxin complexed with HAP peptide
- 9GU1 2.48 Å, Human adult muscle nAChR in resting state in nanodisc with alpha-bungarotoxin
- 2ABX 2.5 Å, The crystal structure of alpha-bungarotoxin at 2.5 Å resolution. Relation to solution…
- 8DA1 2.67 Å, Crystal structure of Krait alpha-neurotoxin in complex with Centi-LNX-D09 antibody
- 6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
- 9GU0 2.96 Å, Human adult muscle nAChR in resting state in detergent with alpha-bungarotoxin
- 1ABT NMR solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
- 1BXP Solution NMR structure of the complex of alpha-bungarotoxin with a library derived…
- 1HAA A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…
Browse structure collections
About this viewer
MolViewer shows 1IDI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.