1IDZ: Myb transforming protein, NMR, 20 structures

Structure of myb transforming protein, NMR, 20 structures. Determined by solution NMR. Released 23 Dec 1996.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 458
Mol. weight: 6.52 kDa
Released: 23 Dec 1996

Explore 1IDZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IDZ contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	149-162	14
α-helix	166-169	4
α-helix	178-187	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mouse C-myb DNA-binding domain repeat 3	A	protein	54	Mus musculus	P06876 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IDZ_1 MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3 (chains A)
MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV

Primary citation

A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy. Furukawa, K., Oda, M., Nakamura, H. Proc Natl Acad Sci U S A (1996) 93:13583-13588. DOI 10.1073/pnas.93.24.13583 · PubMed

Other PDB entries of the same protein (UniProt P06876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GVD 1.45 Å, Crystal structure of C-myb R2 V103L mutant
1GV5 1.58 Å, Crystal structure of C-myb R2
1GUU 1.6 Å, Crystal structure of C-myb R1
1GV2 1.68 Å, Crystal structure of C-myb R2R3
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
1H89 2.45 Å, Crystal structure of ternary protein-DNA COMPLEX2
1H88 2.8 Å, Crystal structure of ternary protein-DNA COMPLEX1
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
1IDY Structure of myb transforming protein, NMR, minimized average structure
1MBE Mouse C-myb DNA-binding domain repeat 1
1MBF Mouse C-myb DNA-binding domain repeat 1
1MBG Mouse C-myb DNA-binding domain repeat 2

Browse structure collections

About this viewer

MolViewer shows 1IDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.