1IFR: Lamin A/C Globular Domain

Structure of Lamin A/C Globular Domain. Determined by X-ray diffraction at 1.4 Å resolution. Released 17 Jul 2002.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 990
Mol. weight: 13.48 kDa
Released: 17 Jul 2002

Explore 1IFR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IFR contains 1 α-helix and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	433-436	4	1
β-strand	440-445	6	2
β-strand	451-456	6	2
β-strand	462-463	2	3
β-strand	468-473	6	1
α-helix	477-478	2
β-strand	479-482	4	1
β-strand	488-489	2	3
β-strand	494-499	6	2
β-strand	507	1	2
β-strand	511-514	4	2
β-strand	526-531	6	1
β-strand	537-543	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lamin A/C	A	protein	121	Homo sapiens	P02545 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IFR_1 Lamin A/C (chains A)
GSHRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKA
GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVE
D

Primary citation

Structure of the globular tail of nuclear lamin. Dhe-Paganon, S., Werner, E.D., Chi, Y.I. et al. J Biol Chem (2002) 277:17381-17384. DOI 10.1074/jbc.C200038200 · PubMed

Other PDB entries of the same protein (UniProt P02545 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WZZ 1.3 Å, Crystal structure of peptide KAGQVVTIW in complex with HLA-B5801
7X1B 1.4 Å, Crystal structure of peptide KAGQVVTI in complex with HLA-B5801
3GEF 1.5 Å, Crystal structure of the R482W mutant of lamin A/C
8I33 1.62 Å, Coil 1a of lamin A (residue 25-65)
7Z21 1.63 Å, BAF A12T bound to the lamin A/C Ig-fold domain
7CRG 1.8 Å, Beta-strand-mediated dimeric formation of the extended Ig-like domains of human lamin A/C
7X5D 1.82 Å, Crystal Structure of the K316C mutant of Human Lamin A/C Coil 2 (residues 244-340)
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
6GHD 2.1 Å, Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies…
7YVD 2.1 Å, The crystal structure of the progerin C-terminal peptide and the Ig-like domain of lamin…
1X8Y 2.2 Å, Human lamin coil 2B
6RPR 2.26 Å, LEM domain of Emerin mutant T43I in complex with BAF dimer and the Igfold of the lamin A/C

Browse structure collections

About this viewer

MolViewer shows 1IFR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.