1IIB: Iibcellobiose from escherichia coli

Crystal structure of iibcellobiose from escherichia coli. Determined by X-ray diffraction at 1.8 Å resolution. Released 24 Dec 1997.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,678
Mol. weight: 22.85 kDa
Released: 24 Dec 1997

Explore 1IIB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IIB contains 16 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
α-helix	13-29	17
β-strand	34-40	7	1
α-helix	41-43	3
α-helix	44-48	5
β-strand	53-56	4	1
α-helix	58-63	6
α-helix	64-70	7
β-strand	76-78	3	1
α-helix	79-80	2
α-helix	81-85	5
α-helix	89-104	16

Chain B: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	2
α-helix	13-29	17
β-strand	34-40	7	2
α-helix	41-43	3
α-helix	48-50	3
β-strand	53-56	4	2
α-helix	58-63	6
α-helix	64-70	7
β-strand	76-78	3	2
α-helix	79-80	2
α-helix	81-85	5
α-helix	89-103	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enzyme iib of the cellobiose-specific phosphotransferase system	A, B	protein	106	Escherichia coli	P69795 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1IIB_1 ENZYME IIB OF THE CELLOBIOSE-SPECIFIC PHOSPHOTRANSFERASE SYSTEM (chains A, B)
MEKKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQI
AYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN

Primary citation

The structure of an energy-coupling protein from bacteria, IIBcellobiose, reveals similarity to eukaryotic protein tyrosine phosphatases. van Montfort, R.L., Pijning, T., Kalk, K.H. et al. Structure (1997) 5:217-225. DOI 10.1016/S0969-2126(97)00180-9 · PubMed

Other PDB entries of the same protein (UniProt P69795 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E2B NMR structure of the C10S mutant of enzyme iib cellobiose of the phosphoenol-pyruvate…
1H9C NMR structure of cysteinyl-phosphorylated enzyme IIB of the N,N'-diacetylchitobiose…
2WWV NMR structure of the IIAchitobiose-IIBchitobiose complex of the N,N'- diacetylchitoboise…
2WY2 NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of…

Browse structure collections

About this viewer

MolViewer shows 1IIB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.