The Solution Structure of The Third Kunitz Domain of Tissue Factor Pathway Inhibitor. Determined by solution NMR. Released 6 Feb 2002.
Explore 1IRH in 3D Show helices and sheets RCSB PDB PDBe
1IRH contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-26 | 4 | 1 |
| β-strand | 33-36 | 4 | 1 |
| β-strand | 48 | 1 | 1 |
| α-helix | 52-54 | 3 | |
| α-helix | 55-59 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| tissue factor pathway inhibitor | A | protein | 61 | Homo sapiens | P10646 (AlphaFold model) |
>1IRH_1 tissue factor pathway inhibitor (chains A) EFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKK G
Structural mechanism for heparin-binding of the third Kunitz domain of human tissue factor pathway inhibitor. Mine, S., Yamazaki, T., Miyata, T. et al. Biochemistry (2002) 41:78-85. DOI 10.1021/bi011299g · PubMed
Other PDB entries of the same protein (UniProt P10646 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1IRH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.