4BQD: KD1 of human TFPI

KD1 of human TFPI in complex with a synthetic peptide. Determined by X-ray diffraction at 2.48 Å resolution. Released 4 Dec 2013.

Method: X-ray diffraction
Resolution: 2.48 Å
Organisms: HOMO SAPIENS, SYNTHETIC CONSTRUCT
Chains: 4
Atoms: 1,591
Mol. weight: 23.47 kDa
Released: 4 Dec 2013

Explore 4BQD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BQD contains 9 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	9-11	3	1
β-strand	19-20	2	1
α-helix	24-27	4
α-helix	29	1
β-strand	30	1	2
β-strand	39-45	7	3
β-strand	50-56	7	3
β-strand	66	1	3
α-helix	69-76	8

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	17-19	3
α-helix	24-27	4
α-helix	29	1
β-strand	30	1	4
β-strand	39-45	7	5
β-strand	50-56	7	5
β-strand	66	1	5
α-helix	69-76	8

Chains C and D: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	6
β-strand	6	1	6
β-strand	8	1	2
α-helix	12-19	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) variant	A, B	protein	79	HOMO SAPIENS	P10646 (AlphaFold model)
Peptide	C, D	protein	21	SYNTHETIC CONSTRUCT

Sequence of entity 1 (A, B), FASTA

>4BQD_1 TISSUE FACTOR PATHWAY INHIBITOR (LIPOPROTEIN-ASSOCIATED COAGULATION INHIBITOR) VARIANT (chains A, B)
DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCE
GNQNRFESLEECKKMCTRD

Sequence of entity 2 (C, D), FASTA

>4BQD_2 PEPTIDE (chains C, D)
XFQSKPNVHVDGYFERLAAKL

Primary citation

Small Peptides Blocking Inhibition of Factor Xa and Tissue Factor-Factor Viia by Tissue Factor Pathway Inhibitor (Tfpi). Dockal, M., Hartman, R., Fries, M. et al. J Biol Chem (2014) 289:1732. DOI 10.1074/JBC.M113.533836 · PubMed

Other PDB entries of the same protein (UniProt P10646 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NMV 1.65 Å, Crystal structure of 2F22 Fab fragment against TFPI1
4DTG 1.8 Å, Hemostatic effect of a monoclonal antibody mAb 2021 blocking the interaction between FXa…
6BX8 1.98 Å, Human Mesotrypsin (PRSS3) Complexed with Tissue Factor Pathway Inhibitor Variant…
1TFX 2.6 Å, Complex of the second kunitz domain of tissue factor pathway inhibitor with porcine…
7V1N 3.2 Å, Structure of the Clade 2 C. difficile TcdB in complex with its receptor TFPI
9P0X 3.7 Å, Nanodisc-embedded human TF/FVIIa/XK1 in complex with 10H10 Fab (nanodisc-subtracted)
1ADZ The solution structure of the second kunitz domain of tissue factor pathway inhibitor,…
1IRH The Solution Structure of The Third Kunitz Domain of Tissue Factor Pathway Inhibitor

Browse structure collections

About this viewer

MolViewer shows 4BQD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.