4DTG: PDB entry 4DTG

Hemostatic effect of a monoclonal antibody mAb 2021 blocking the interaction between FXa and TFPI in a rabbit hemophilia model. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Jun 2012.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,431
Mol. weight: 57.1 kDa
Released: 13 Jun 2012

Explore 4DTG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DTG contains 20 α-helices and 50 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	9
β-strand	45-51	7	9
β-strand	58-59	2	9
β-strand	65	1	7
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-99	8	9
α-helix	102-104	3
β-strand	108-109	2	9
β-strand	115-117	3	9
β-strand	118-119	2	8
α-helix	123-124	2
β-strand	125	1	10
α-helix	126-127	2
β-strand	128-132	5	11
β-strand	143-153	11	11
β-strand	154	1	10
β-strand	159-162	4	12
α-helix	163-165	3
β-strand	167	1	12
β-strand	171-173	3	11
α-helix	174-176	3
β-strand	177-178	2	11
β-strand	184-193	10	11
α-helix	194-196	3
β-strand	203-208	6	12
α-helix	209-211	3
β-strand	213-218	6	12

Chain K: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	10-11	2
β-strand	20-26	7	13
β-strand	31-37	7	13
β-strand	47	1	13
α-helix	50-53	4
α-helix	54-58	5

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	50-54	5	2
β-strand	58-59	2	2
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158-159	2	6
β-strand	164-168	5	5
α-helix	170-172	3
β-strand	178-187	10	5
α-helix	188-191	4
β-strand	196-202	7	6
β-strand	210-215	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain	L	protein	219	Homo sapiens
Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, heavy chain	H	protein	222	Homo sapiens
Tissue factor pathway inhibitor	K	protein	66	Homo sapiens	P10646 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>4DTG_1 Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain (chains L)
DIVMTQTPLSLSVTPGQPASISCKSSQSLLESDGKTYLNWYLQKPGQSPQLLIYLVSILD
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQATHFPQTFGGGTKVEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (H), FASTA

>4DTG_2 Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, heavy chain (chains H)
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNYAMSWVRQTPEKRLEWVATISRSGSYSYF
PDSVQGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGYDEGDAMDSWGQGTTVTVS
SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESK

Sequence of entity 3 (K), FASTA

>4DTG_3 Tissue factor pathway inhibitor (chains K)
QEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDG
HHHHHH

Primary citation

Hemostatic effect of a monoclonal antibody mAb 2021 blocking the interaction between FXa and TFPI in a rabbit hemophilia model. Hilden, I., Lauritzen, B., Sorensen, B.B. et al. Blood (2012) 119:5871-5878. DOI 10.1182/blood-2012-01-401620 · PubMed

Other PDB entries of the same protein (UniProt P10646 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NMV 1.65 Å, Crystal structure of 2F22 Fab fragment against TFPI1
6BX8 1.98 Å, Human Mesotrypsin (PRSS3) Complexed with Tissue Factor Pathway Inhibitor Variant…
4BQD 2.48 Å, KD1 of human TFPI in complex with a synthetic peptide
1TFX 2.6 Å, Complex of the second kunitz domain of tissue factor pathway inhibitor with porcine…
7V1N 3.2 Å, Structure of the Clade 2 C. difficile TcdB in complex with its receptor TFPI
9P0X 3.7 Å, Nanodisc-embedded human TF/FVIIa/XK1 in complex with 10H10 Fab (nanodisc-subtracted)
1ADZ The solution structure of the second kunitz domain of tissue factor pathway inhibitor,…
1IRH The Solution Structure of The Third Kunitz Domain of Tissue Factor Pathway Inhibitor

Browse structure collections

About this viewer

MolViewer shows 4DTG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.