1IRS: Irs-1 ptb domain

Irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, NMR, minimized average structure. Determined by solution NMR. Released 15 May 1997.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 971
Mol. weight: 13.89 kDa
Released: 15 May 1997

Explore 1IRS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IRS contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	162-168	7	1
α-helix	173-176	4
β-strand	182-188	7	1
β-strand	191-196	6	1
β-strand	204-207	4	1
β-strand	211-217	7	1
β-strand	220-225	6	1
β-strand	234-236	3	1
β-strand	238-239	2	1
α-helix	245-262	18

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	495-497	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IRS-1	A	protein	112	Homo sapiens	P35568 (AlphaFold model)
Il-4 receptor phosphopeptide	B	protein	11	Homo sapiens	P24394 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IRS_1 IRS-1 (chains A)
MGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCG
HSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPR

Sequence of entity 2 (B), FASTA

>1IRS_2 IL-4 RECEPTOR PHOSPHOPEPTIDE (chains B)
LVIAGNPAYRS

Primary citation

Structural basis for IL-4 receptor phosphopeptide recognition by the IRS-1 PTB domain. Zhou, M.M., Huang, B., Olejniczak, E.T. et al. Nat Struct Biol (1996) 3:388-393. DOI 10.1038/nsb0496-388 · PubMed

Other PDB entries of the same protein (UniProt P35568 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PPM 1.48 Å, SHP2 catalytic domain in complex with IRS1 (889-901) phosphopeptide (pSer-892, pTyr-896)
7PPL 1.53 Å, SHP2 catalytic domain in complex with IRS1 (625-639) phosphopeptide (pTyr-632, pSer-636)
5U1M 1.8 Å, Structure of the IRS-1 PTB Domain Bound to the Juxtamembrane Region of the Insulin…
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
1QQG 2.3 Å, Crystal structure of the PH-ptb targeting region of irs-1
6BNT 3.2 Å, Crystal structure of AP2 mu1 adaptin C-terminal domain with IRS-1 peptide
2Z8C 3.25 Å, Phosphorylated insulin receptor tyrosine kinase in complex with…

Browse structure collections

About this viewer

MolViewer shows 1IRS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.