1J0S: Human interleukin-18

Solution structure of the human interleukin-18. Determined by solution NMR. Released 11 Nov 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,274
Mol. weight: 18.24 kDa
Released: 11 Nov 2003

Explore 1J0S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J0S contains 4 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	10-13	4	2
β-strand	18-22	5	2
β-strand	28-32	5	2
β-strand	48-52	5	1
α-helix	53	1
β-strand	60-62	3	2
β-strand	64-66	3	1
β-strand	72-76	5	1
β-strand	81-84	4	1
α-helix	87-89	3
β-strand	101-105	5	2
α-helix	106	1
β-strand	112-117	6	2
β-strand	124-130	7	2
β-strand	133-139	7	2
α-helix	147-149	3
β-strand	151-155	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-18	A	protein	157	Homo sapiens	Q14116 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1J0S_1 Interleukin-18 (chains A)
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGM
AVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSY
EGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED

Primary citation

The structure and binding mode of interleukin-18. Kato, Z., Jee, J., Shikano, H. et al. Nat Struct Biol (2003) 10:966-971. DOI 10.1038/nsb993 · PubMed

Other PDB entries of the same protein (UniProt Q14116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VXT 1.49 Å, Crystal structure of human IL-18 complexed to murine reference antibody 125-2H Fab
9OD9 1.6 Å, Structure of disulfide-stabilized IL-18 variant
4EKX 1.75 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
9OD7 1.9 Å, Structure of disulfide-stabilized IL-18 variant
4XFS 1.91 Å, Structure of IL-18 SER Mutant I
3F62 2.0 Å, Crystal Structure of Human IL-18 in complex with Ectromelia virus IL-18 Binding Protein
4XFT 2.0 Å, Structure of IL-18 SER Mutant III
4HJJ 2.1 Å, Structure Reveals Function of the Dual Variable Domain Immunoglobulin (DVD-Ig) Molecule
3WO2 2.33 Å, Crystal structure of human interleukin-18
4EEE 2.71 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
4R6U 2.8 Å, IL-18 receptor complex

Browse structure collections

About this viewer

MolViewer shows 1J0S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.