Structure of FLIN2, a complex containing the N-terminal LIM domain of LMO2 and ldb1-LID. Determined by solution NMR. Released 13 May 2003.
Explore 1J2O in 3D Show helices and sheets RCSB PDB PDBe
1J2O contains 1 α-helix and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 1 |
| β-strand | 6 | 1 | 2 |
| β-strand | 13 | 1 | 1 |
| β-strand | 17-20 | 4 | 2 |
| β-strand | 25-26 | 2 | 2 |
| β-strand | 50 | 1 | 3 |
| β-strand | 53 | 1 | 3 |
| α-helix | 57-64 | 8 | |
| β-strand | 72 | 1 | 4 |
| β-strand | 88 | 1 | 4 |
| β-strand | 98-101 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fusion of Rhombotin-2 and LIM domain-binding protein 1 | A | protein | 114 | Mus musculus | P25801 (AlphaFold model), P70662 (AlphaFold model) |
>1J2O_1 Fusion of Rhombotin-2 and LIM domain-binding protein 1 (chains A) GSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDY LRLGGSGGHMGSGGDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Structural basis for the recognition of ldb1 by the N-terminal LIM domains of LMO2 and LMO4. Deane, J.E., Mackay, J.P., Kwan, A.H. et al. EMBO J (2003) 22:2224-2233. DOI 10.1093/emboj/cdg196 · PubMed
Other PDB entries of the same protein (UniProt P25801 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1J2O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.