2LXD: Rhombotin-2,LIM domain-binding protein 1

Backbone 1H, 13C, and 15N Chemical Shift Assignments for LMO2(LIM2)-Ldb1(LID). Determined by solution NMR. Released 12 Sept 2012.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 954
Mol. weight: 13.94 kDa
Ligands: ZN
Released: 12 Sept 2012

Explore 2LXD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LXD contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	16	1	1
β-strand	31	1	1
β-strand	38	1	2
β-strand	39	1	3
α-helix	44	1
β-strand	45	1	2
α-helix	46	1
β-strand	51-52	2	4
β-strand	53-54	2	3
β-strand	59-60	2	3
α-helix	65-72	8
β-strand	86-87	2	4
α-helix	89-91	3
α-helix	102-105	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rhombotin-2,LIM domain-binding protein 1	A	protein	125	Mus musculus	P25801 (AlphaFold model), P70662 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LXD_1 Rhombotin-2,LIM domain-binding protein 1 (chains A)
GSYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFSVGDRYLLINSD
IVCEQDIYEWTKINGGSGGSGGSGGDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAAN
GIDDE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Solution structure of a tethered Lmo2(LIM2) /Ldb1(LID) complex. Dastmalchi, S., Wilkinson-White, L., Kwan, A.H. et al. Protein Sci (2012) 21:1768-1774. DOI 10.1002/pro.2153 · PubMed

Other PDB entries of the same protein (UniProt P25801 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2O Structure of FLIN2, a complex containing the N-terminal LIM domain of LMO2 and ldb1-LID
2L6Y haddock model of GATA1NF:Lmo2LIM2-Ldb1LID
2L6Z haddock model of GATA1NF:Lmo2LIM2-Ldb1LID with FOG

Browse structure collections

About this viewer

MolViewer shows 2LXD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.