2L6Y: Haddock model of GATA1NF:Lmo2LIM2-Ldb1LID

haddock model of GATA1NF:Lmo2LIM2-Ldb1LID. Determined by solution NMR. Released 31 Aug 2011.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 1,043
Mol. weight: 15.18 kDa
Ligands: ZN
Released: 31 Aug 2011

Explore 2L6Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L6Y contains 6 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	216	1	1
β-strand	224	1	1
α-helix	229-234	6

Chain B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	93	1	2
α-helix	99	1
β-strand	100	1	2
α-helix	101	1
β-strand	108	1	3
β-strand	122	1	4
β-strand	134-135	2	5
β-strand	136-137	2	4
β-strand	142-143	2	4
α-helix	148-155	8
β-strand	169-170	2	5
α-helix	173	1
β-strand	174	1	3
α-helix	175	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Erythroid transcription factor	A	protein	39	Mus musculus	P17679 (AlphaFold model)
LIM domain only 2, linker, LIM domain-binding protein 1	B	protein	96	Mus musculus	P25801 (AlphaFold model), P70662 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L6Y_1 Erythroid transcription factor (chains A)
EARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQN

Sequence of entity 2 (B), FASTA

>2L6Y_2 LIM domain only 2, linker, LIM domain-binding protein 1 (chains B)
YLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFSVGDRYLLINSDIV
CEQDIYEWTKINGGSGGSGGSGGDVMVVGEPTLMGG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural basis of simultaneous recruitment of the transcriptional regulators LMO2 and FOG1/ZFPM1 by the transcription factor GATA1. Wilkinson-White, L., Gamsjaeger, R., Dastmalchi, S. et al. Proc Natl Acad Sci U S A (2011) 108:14443-14448. DOI 10.1073/pnas.1105898108 · PubMed

Other PDB entries of the same protein (UniProt P17679 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VD6 1.98 Å, Both Zn Fingers of GATA1 Bound to Palindromic DNA Recognition Site, P21 Crystal Form
3VEK 2.63 Å, Both Zn Fingers of GATA1 Bound to Palindromic DNA Recognition Site, P1 Crystal Form
1GNF Solution structure of the N-terminal zinc finger of murine gata-1, NMR, 25 structures
1Y0J Zinc fingers as protein recognition motifs: structural basis for the GATA-1/Friend of…
2L5E Complex between BD1 of Brd3 and GATA-1 C-tail
2L6Z haddock model of GATA1NF:Lmo2LIM2-Ldb1LID with FOG

Browse structure collections

About this viewer

MolViewer shows 2L6Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.