haddock model of GATA1NF:Lmo2LIM2-Ldb1LID. Determined by solution NMR. Released 31 Aug 2011.
Explore 2L6Y in 3D Show helices and sheets RCSB PDB PDBe
2L6Y contains 6 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 216 | 1 | 1 |
| β-strand | 224 | 1 | 1 |
| α-helix | 229-234 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 93 | 1 | 2 |
| α-helix | 99 | 1 | |
| β-strand | 100 | 1 | 2 |
| α-helix | 101 | 1 | |
| β-strand | 108 | 1 | 3 |
| β-strand | 122 | 1 | 4 |
| β-strand | 134-135 | 2 | 5 |
| β-strand | 136-137 | 2 | 4 |
| β-strand | 142-143 | 2 | 4 |
| α-helix | 148-155 | 8 | |
| β-strand | 169-170 | 2 | 5 |
| α-helix | 173 | 1 | |
| β-strand | 174 | 1 | 3 |
| α-helix | 175 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Erythroid transcription factor | A | protein | 39 | Mus musculus | P17679 (AlphaFold model) |
| LIM domain only 2, linker, LIM domain-binding protein 1 | B | protein | 96 | Mus musculus | P25801 (AlphaFold model), P70662 (AlphaFold model) |
>2L6Y_1 Erythroid transcription factor (chains A) EARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQN
>2L6Y_2 LIM domain only 2, linker, LIM domain-binding protein 1 (chains B) YLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFSVGDRYLLINSDIV CEQDIYEWTKINGGSGGSGGSGGDVMVVGEPTLMGG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Structural basis of simultaneous recruitment of the transcriptional regulators LMO2 and FOG1/ZFPM1 by the transcription factor GATA1. Wilkinson-White, L., Gamsjaeger, R., Dastmalchi, S. et al. Proc Natl Acad Sci U S A (2011) 108:14443-14448. DOI 10.1073/pnas.1105898108 · PubMed
Other PDB entries of the same protein (UniProt P17679 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2L6Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.