1JBD: Long neurotoxin 1

Name: PDB 1JBD: NMR Structure of the Complex Between alpha-bungarotoxin and a Mimotope of the Nicotinic Acetylcholine Receptor
Published: 2001-06-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

NMR Structure of the Complex Between alpha-bungarotoxin and a Mimotope of the Nicotinic Acetylcholine Receptor. Determined by solution NMR. Released 27 Jun 2001.

Method: Solution NMR
Organism: Bungarus multicinctus
Chains: 2
Atoms: 681
Mol. weight: 9.85 kDa
Released: 27 Jun 2001

Explore 1JBD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JBD contains 0 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	12	1	1
β-strand	18	1	2
β-strand	20	1	2
β-strand	22-28	7	3
β-strand	39-45	7	3
β-strand	57-60	4	3

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	4	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Long neurotoxin 1	A	protein	74	Bungarus multicinctus	P60615 (AlphaFold model)
Mimotope of the nicotinic acetylcholine receptor	B	protein	14

Sequence of entity 1 (A), FASTA

>1JBD_1 LONG NEUROTOXIN 1 (chains A)
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG

Sequence of entity 2 (B), FASTA

>1JBD_2 MIMOTOPE OF THE NICOTINIC ACETYLCHOLINE RECEPTOR (chains B)
HRYYESSLEPWYPD

Primary citation

NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor. Scarselli, M., Spiga, O., Ciutti, A. et al. Biochemistry (2002) 41:1457-1463. DOI 10.1021/bi011012f · PubMed

Other PDB entries of the same protein (UniProt P60615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FYS 1.32 Å, D11 mAbs bound to alpha-Bungarotoxin
9HUB 1.33 Å, D11 mAbs bound to alpha-Bungarotoxin at pH 7.5
1HC9 1.8 Å, alpha-bungarotoxin complexed with high affinity peptide
8VY8 2.4 Å, Recombinant alpha bungarotoxin complexed with HAP peptide
9GU1 2.48 Å, Human adult muscle nAChR in resting state in nanodisc with alpha-bungarotoxin
2ABX 2.5 Å, The crystal structure of alpha-bungarotoxin at 2.5 Å resolution. Relation to solution…
8DA1 2.67 Å, Crystal structure of Krait alpha-neurotoxin in complex with Centi-LNX-D09 antibody
6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
9GU0 2.96 Å, Human adult muscle nAChR in resting state in detergent with alpha-bungarotoxin
1ABT NMR solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
1BXP Solution NMR structure of the complex of alpha-bungarotoxin with a library derived…
1HAA A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…

Browse structure collections

About this viewer

MolViewer shows 1JBD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.