1JGN: Polyadenylate-binding protein 1

Solution structure of the C-terminal PABC domain of human poly(A)-binding protein in complex with the peptide from Paip2. Determined by solution NMR. Released 24 Jun 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 891
Mol. weight: 12.74 kDa
Released: 24 Jun 2003

Explore 1JGN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JGN contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	8-13	6
α-helix	17-19	3
α-helix	28-34	7
α-helix	40-46	7
α-helix	47-49	3
α-helix	52-60	9
α-helix	62-79	18
α-helix	81-84	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
polyadenylate-binding protein 1	A	protein	98	Homo sapiens	P11940 (AlphaFold model)
polyadenylate-binding protein-interacting protein 2	B	protein	22	Homo sapiens	Q9BPZ3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JGN_1 polyadenylate-binding protein 1 (chains A)
GPLGSPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLE
SPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV

Sequence of entity 2 (B), FASTA

>1JGN_2 polyadenylate-binding protein-interacting protein 2 (chains B)
VVKSNLNPNAKEFVPGVKYGNI

Primary citation

Structural basis of ligand recognition by PABC, a highly specific peptide-binding domain found in poly(A)-binding protein and a HECT ubiquitin ligase. Kozlov, G., De Crescenzo, G., Lim, N.S. et al. EMBO J (2004) 23:272-281. DOI 10.1038/sj.emboj.7600048 · PubMed

Other PDB entries of the same protein (UniProt P11940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KUJ 1.4 Å, Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a
3KUS 1.4 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
2X04 1.49 Å, Crystal structure of the PABC-TNRC6C complex
3KTP 1.5 Å, Structural basis of GW182 recognition by poly(A)-binding protein
3KUT 1.5 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
3KTR 1.7 Å, Structural basis of ataxin-2 recognition by poly(A)-binding protein
3PTH 1.7 Å, The PABC1 MLLE domain bound to the variant PAM2 motif of LARP4B
3PKN 1.8 Å, Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif…
4F25 1.9 Å, Crystal structure of the second RRM domain of human PABPC1 at pH 6.0
5DX1 1.93 Å, Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455)
7BN3 1.93 Å, Crystal structure of C-terminal domain of PABPC1 in complex with Nucleoprotein from…
5DX8 1.94 Å, Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455)

Browse structure collections

About this viewer

MolViewer shows 1JGN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.