1JHG: Trp repressor mutant V58I
Trp repressor mutant V58I. Determined by X-ray diffraction at 1.3 Å resolution. Released 12 Mar 1997.
- Method
- X-ray diffraction
- Resolution
- 1.3 Å
- Organism
- Escherichia coli
- Chains
- 1
- Atoms
- 1,015
- Mol. weight
- 11.88 kDa
- Ligands
- TRP, PO4
- Released
- 12 Mar 1997
Explore 1JHG in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1JHG contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-31 | 23 | |
| α-helix | 35-42 | 8 | |
| α-helix | 45-63 | 19 | |
| α-helix | 68-75 | 8 | |
| α-helix | 79-91 | 13 | |
| α-helix | 94-104 | 11 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Trp operon repressor | A | protein | 101 | Escherichia coli | P0A881 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>1JHG_1 TRP OPERON REPRESSOR (chains A)
SAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIIEELLRGEMS
QRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| TRP | Tryptophan | C11 H12 N2 O2 | 1 |
| PO4 | Phosphate ion | O4 P | 1 |
Primary citation
An atomic view of the L-tryptophan binding site of trp repressor. Lawson, C.L. Nat Struct Biol (1996) 3:986-987. PubMed
Other PDB entries of the same protein (UniProt P0A881 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6ENI 1.1 Å, Tryptophan Repressor TrpR from E.coli variant T44L S88Y with Indole-3-acetic acid as…
- 6ENN 1.17 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M N87G S88Y with Indole-3-acetic…
- 6FAL 1.2 Å, Tryptophan Repressor TrpR from E.coli with 3-Indolepropionic acid as ligand
- 6ELG 1.38 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81I S88Y with…
- 6F9K 1.4 Å, Tryptophan Repressor TrpR from E.coli with 5-methyl-L-tryptophan as ligand
- 6ELB 1.44 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81M N87G S88Y with…
- 6EKP 1.46 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M S88Y with Indole-3-acetic acid…
- 3SSX 1.58 Å, E. coli trp aporeporessor L75F mutant
- 2OZ9 1.65 Å, E. coli TRP holorepressor, orthorhombic crystal form
- 6F7G 1.66 Å, Tryptophan Repressor TrpR from E.coli with 5-Methyltryptamine
- 3SSW 1.67 Å, E. coli trp aporepressor
- 3WRP 1.8 Å, Flexibility of the DNA-binding domains of trp repressor
Browse structure collections
About this viewer
MolViewer shows 1JHG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.