1JIC: SSO7D

Solution NMR structure of recombinant SSO7D with RNase activity, minimized average structure. Determined by solution NMR. Released 14 Oct 1998.

Method: Solution NMR
Organism: Sulfolobus solfataricus
Chains: 1
Atoms: 493
Mol. weight: 7.03 kDa
Released: 14 Oct 1998

Explore 1JIC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JIC contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	11-15	5	1
β-strand	19-24	6	2
β-strand	28-34	7	2
β-strand	40-46	7	2
α-helix	53-56	4
α-helix	57-61	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SSO7D	A	protein	62	Sulfolobus solfataricus	P39476 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JIC_1 SSO7D (chains A)
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEK
QK

Primary citation

A single-point mutation in the extreme heat- and pressure-resistant sso7d protein from sulfolobus solfataricus leads to a major rearrangement of the hydrophobic core. Consonni, R., Santomo, L., Fusi, P. et al. Biochemistry (1999) 38:12709-12717. DOI 10.1021/bi9911280 · PubMed

Other PDB entries of the same protein (UniProt P39476 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1C8C 1.45 Å, Crystal structures of the chromosomal proteins SSO7D/SAC7D bound to DNA containing T-G…
1BNZ 2.0 Å, SSO7D hyperthermophile protein/dna complex
5B02 2.21 Å, Structure of the prenyltransferase MoeN5 with a fusion protein tag of Sso7d
6J8V 2.23 Å, Structure of MOEN5-SSO7D fusion protein in complex with ligand 2
5B0I 2.26 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-octyl glucoside
5GWW 2.3 Å, Structure of MoeN5-Sso7d fusion protein in complex with a permethylated substrate analogue
6J8W 2.35 Å, Structure of MOEN5-SSO7D fusion protein in complex with lig 1
5GWV 2.4 Å, Structure of MoeN5-Sso7d fusion protein in complex with a substrate analogue
5B0J 2.5 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-undecyl maltoside
5B03 2.6 Å, Structure of MoeN5-Sso7d fusion protein in complex with geranyl pyrophosphate
5B0K 2.75 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-decyl maltoside
5B0L 2.8 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside

Browse structure collections

About this viewer

MolViewer shows 1JIC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.