1JID: Human SRP19

Human SRP19 in complex with helix 6 of Human SRP RNA. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Oct 2001.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,828
Mol. weight: 24.47 kDa
Ligands: MG
Released: 19 Oct 2001

Explore 1JID in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JID contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
β-strand	16-18	3	1
α-helix	20-23	4
β-strand	24	1	2
β-strand	41	1	2
α-helix	46-55	10
β-strand	60-63	4	1
α-helix	76-78	3
β-strand	81-84	4	1
β-strand	87	1	3
β-strand	93	1	3
α-helix	101-111	11
α-helix	112-114	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Helix 6 of human srp RNA	B	RNA	29
Signal recognition particle 19 kda protein	A	protein	128	Homo sapiens	P09132 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1JID_1 HELIX 6 OF HUMAN SRP RNA (chains B)
GGUGACCUCCCGGGAGCGGGGGACCACUA

Sequence of entity 2 (A), FASTA

>1JID_2 SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN (chains A)
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ
LEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

Crystal structure of an early protein-RNA assembly complex of the signal recognition particle. Wild, K., Sinning, I., Cusack, S. Science (2001) 294:598-601. DOI 10.1126/science.1063839 · PubMed

Other PDB entries of the same protein (UniProt P09132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QWQ 2.83 Å, Ternary complex of ribosome nascent chain with SRP and NAC
1MFQ 3.1 Å, Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition…
7NFX 3.2 Å, Mammalian ribosome nascent chain complex with SRP and SRP receptor in early state A
5M73 3.4 Å, Structure of the human SRP S domain with SRP72 RNA-binding domain
4P3E 3.5 Å, Structure of the human SRP S domain
3KTV 3.8 Å, Crystal structure of the human SRP19/S-domain SRP RNA complex
2J37 8.7 Å, Model of mammalian srp bound to 80S rncs
1RY1 12.0 Å, Structure of the signal recognition particle interacting with the elongation-arrested…

Browse structure collections

About this viewer

MolViewer shows 1JID directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.