1JM7: BRCA1/BARD1 RING-domain heterodimer

Solution structure of the BRCA1/BARD1 RING-domain heterodimer. Determined by solution NMR. Released 3 Oct 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,573
Mol. weight: 26.25 kDa
Ligands: ZN
Released: 3 Oct 2001

Explore 1JM7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JM7 contains 9 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	8-21	14
β-strand	36	1	1
α-helix	46-53	8
β-strand	74	1	1
α-helix	81-96	16

Chain B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	35-46	12
β-strand	61	1	2
β-strand	70	1	2
α-helix	75-78	4
β-strand	82	1	3
α-helix	88	1
β-strand	89	1	3
α-helix	90	1
α-helix	99-116	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Breast cancer type 1 susceptibility protein	A	protein	112	Homo sapiens	P38398 (AlphaFold model)
BRCA1-associated ring domain protein 1	B	protein	117	Homo sapiens	Q99728 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JM7_1 BREAST CANCER TYPE 1 SUSCEPTIBILITY PROTEIN (chains A)
MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKGK

Sequence of entity 2 (B), FASTA

>1JM7_2 BRCA1-ASSOCIATED RING DOMAIN PROTEIN 1 (chains B)
MEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPV
CYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKKGK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structure of a BRCA1-BARD1 heterodimeric RING-RING complex. Brzovic, P.S., Rajagopal, P., Hoyt, D.W. et al. Nat Struct Biol (2001) 8:833-837. DOI 10.1038/nsb1001-833 · PubMed

Other PDB entries of the same protein (UniProt P38398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RS8 1.31 Å, Crystal structure of BRCA1 BRCTs in complex with a RIF1 phosphopeptide
4IGK 1.75 Å, Structure of human BRCA1 BRCT in complex with ATRIP peptide
1T15 1.85 Å, Crystal Structure of the Brca1 BRCT Domains in Complex with the Phosphorylated…
4IFI 2.2 Å, Structure of human BRCA1 BRCT in complex with BAAT peptide
1T29 2.3 Å, Crystal structure of the BRCA1 BRCT repeats bound to a phosphorylated BACH1 peptide
1JNX 2.5 Å, Crystal structure of the BRCT repeat region from the breast cancer associated protein,…
1Y98 2.5 Å, Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.
3PXB 2.5 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: T1700A
4Y2G 2.5 Å, Structure of BRCA1 BRCT domains in complex with Abraxas single phosphorylated peptide
3PXA 2.55 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: G1656D
3K0H 2.7 Å, The crystal structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide…
3K0K 2.7 Å, Crystal Structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide with…

Browse structure collections

About this viewer

MolViewer shows 1JM7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.