1JQH: IGF-1 receptor kinase domain

IGF-1 receptor kinase domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 19 Apr 2002.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,292
Mol. weight: 107.14 kDa
Ligands: MG, ANP
Released: 19 Apr 2002

Explore 1JQH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JQH contains 57 α-helices and 42 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	986-987	2	1
β-strand	993	1	2
β-strand	999-1007	9	2
β-strand	1012-1022	11	2
β-strand	1025-1034	10	2
α-helix	1041-1051	11
α-helix	1052-1056	5
β-strand	1062	1	3
α-helix	1063-1064	2
β-strand	1065-1069	5	2
β-strand	1076-1080	5	2
β-strand	1086	1	3
α-helix	1087-1094	8
α-helix	1109-1128	20
β-strand	1131-1132	2	4
α-helix	1138-1140	3
β-strand	1141-1143	3	3
β-strand	1149-1151	3	3
α-helix	1152-1153	2
β-strand	1167-1168	2	4
β-strand	1172-1173	2	5
α-helix	1176-1178	3
α-helix	1181-1186	6
α-helix	1191-1206	16
α-helix	1210-1211	2
α-helix	1218-1226	9
α-helix	1231-1234	4
α-helix	1239-1248	10
α-helix	1253-1255	3
α-helix	1257-1258	2
α-helix	1259-1264	6
α-helix	1267-1269	3
α-helix	1274-1277	4

Chains B and C: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	986-987	2	6
β-strand	993	1	7
β-strand	999-1007	9	7
β-strand	1012-1022	11	7
β-strand	1025-1034	10	7
α-helix	1041-1051	11
α-helix	1052-1056	5
β-strand	1062	1	8
α-helix	1063-1064	2
β-strand	1065-1069	5	7
β-strand	1076-1080	5	7
β-strand	1086	1	8
α-helix	1087-1092	6
α-helix	1109-1128	20
β-strand	1131-1132	2	9
α-helix	1138-1140	3
β-strand	1141-1143	3	8
β-strand	1149-1151	3	8
α-helix	1152-1153	2
β-strand	1167-1168	2	9
β-strand	1172-1173	2	1
α-helix	1176-1178	3
α-helix	1181-1186	6
α-helix	1191-1206	16
α-helix	1210-1211	2
α-helix	1218-1226	9
α-helix	1231-1234	4
α-helix	1239-1248	10
α-helix	1253-1255	3
α-helix	1257-1258	2
α-helix	1259-1264	6
α-helix	1267-1269	3
α-helix	1274-1277	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGF-1 receptor kinase	A, B, C	protein	308	Homo sapiens	P08069 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1JQH_1 IGF-1 receptor kinase (chains A, B, C)
GSFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEA
ASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEM
ENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTR
DIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSN
EQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVS
FYYSEENK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	3

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal structure of bisphosphorylated IGF-1 receptor kinase: insight into domain movements upon kinase activation. Pautsch, A., Zoephel, A., Ahorn, H. et al. Structure (2001) 9:955-965. DOI 10.1016/S0969-2126(01)00655-4 · PubMed

Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1P4O 1.5 Å, Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.
8PYN 1.71 Å, Human IGF1R with inhibitor 56
3LW0 1.79 Å, IGF-1RK in complex with ligand MSC1609119A-1
5FXS 1.9 Å, IGFR-1R complex with a pyrimidine inhibitor.
2OJ9 2.0 Å, Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
3I81 2.08 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with…
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
3O23 2.1 Å, Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor
4D2R 2.1 Å, Human IGF in complex with a Dyrk1B inhibitor
3NW7 2.11 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW5 2.14 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW6 2.2 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…

Browse structure collections

About this viewer

MolViewer shows 1JQH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.