2OJ9: IGF-1R kinase domain

Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor. Determined by X-ray diffraction at 2.0 Å resolution. Released 1 May 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,592
Mol. weight: 35.44 kDa
Ligands: BMI
Released: 1 May 2007

Explore 2OJ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OJ9 contains 21 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	963	1	1
α-helix	966-968	3
β-strand	969-977	9	1
β-strand	982-992	11	1
β-strand	995-1004	10	1
α-helix	1011-1021	11
α-helix	1022-1026	5
β-strand	1032	1	2
α-helix	1033-1034	2
β-strand	1035-1039	5	1
α-helix	1045	1
β-strand	1046-1050	5	1
β-strand	1056	1	2
α-helix	1057-1062	6
α-helix	1079-1098	20
α-helix	1108-1110	3
β-strand	1111-1113	3	2
β-strand	1119-1121	3	2
α-helix	1132-1134	3
β-strand	1136-1138	3	3
β-strand	1142-1144	3	3
α-helix	1146-1148	3
α-helix	1151-1156	6
α-helix	1161-1176	16
α-helix	1180-1181	2
α-helix	1188-1196	9
α-helix	1201-1204	4
α-helix	1209-1218	10
α-helix	1223-1225	3
α-helix	1227-1228	2
α-helix	1229-1236	8
α-helix	1237-1239	3
α-helix	1244-1247	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin-like growth factor 1 receptor precursor (EC 2.7.10.1) (Insulin-like growth factor I…	A	protein	307	Homo sapiens	P08069 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OJ9_1 Insulin-like growth factor 1 receptor precursor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD221 antigen) (chains A)
MVSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAA
SMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEME
NNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRD
IYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNE
QVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSF
YYSEENK

Ligands and cofactors

ID	Name	Formula	Copies
BMI	3-[5-(1H-imidazol-1-yl)-7-methyl-1H-benzimidazol-2-yl]-4-[(pyridin-2-ylmethyl)a…	C22 H19 N7 O	1

Primary citation

Discovery and initial SAR of 3-(1H-benzo[d]imidazol-2-yl)pyridin-2(1H)-ones as inhibitors of insulin-like growth factor 1-receptor (IGF-1R). Velaparthi, U., Wittman, M., Liu, P. et al. Bioorg Med Chem Lett (2007) 17:2317-2321. DOI 10.1016/j.bmcl.2007.01.102 · PubMed

Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1P4O 1.5 Å, Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.
8PYN 1.71 Å, Human IGF1R with inhibitor 56
3LW0 1.79 Å, IGF-1RK in complex with ligand MSC1609119A-1
5FXS 1.9 Å, IGFR-1R complex with a pyrimidine inhibitor.
3I81 2.08 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with…
1JQH 2.1 Å, IGF-1 receptor kinase domain
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
3O23 2.1 Å, Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor
4D2R 2.1 Å, Human IGF in complex with a Dyrk1B inhibitor
3NW7 2.11 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW5 2.14 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW6 2.2 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…

Browse structure collections

About this viewer

MolViewer shows 2OJ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.