1JXM: GMP bound SH3-hook-gk fragment of psd-95

Crystal structure of the GMP bound SH3-hook-gk fragment of psd-95. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Jan 2002.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 2,204
Mol. weight: 35.53 kDa
Ligands: 5GP, GAI
Released: 16 Jan 2002

Explore 1JXM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JXM contains 13 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	431-435	5	1
β-strand	451	1	1
α-helix	452-453	2
β-strand	459-464	6	1
β-strand	470-475	6	1
β-strand	487-489	3	1
α-helix	491-501	11
β-strand	523-525	3	1
β-strand	526-530	5	2
α-helix	534-536	3
β-strand	537-540	4	3
α-helix	544-554	11
β-strand	559-560	2	4
α-helix	562-564	3
β-strand	565-566	2	5
α-helix	569-571	3
β-strand	576	1	6
β-strand	580	1	6
β-strand	581-582	2	5
α-helix	586-594	9
β-strand	598-604	7	5
β-strand	607-612	6	5
α-helix	613-621	9
β-strand	625-626	2	4
β-strand	627-628	2	3
α-helix	634-640	7
β-strand	646-650	5	3
α-helix	655-661	7
α-helix	667-684	18
α-helix	685-687	3
β-strand	690-692	3	3
α-helix	697-711	15
β-strand	715-719	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Postsynaptic density protein	A	protein	301	Rattus norvegicus	P31016 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JXM_1 POSTSYNAPTIC DENSITY PROTEIN (chains A)
GSHMASGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETD
DIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPT
KDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQ
YNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINK
RITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARER
L

Ligands and cofactors

ID	Name	Formula	Copies
5GP	Guanosine-5'-monophosphate	C10 H14 N5 O8 P	1
GAI	Guanidine	C H5 N3	2

Water and common crystallization additives (MPD) are not listed.

Primary citation

Structural characterization of the intramolecular interaction between the SH3 and guanylate kinase domains of PSD-95. Tavares, G.A., Panepucci, E.H., Brunger, A.T. Mol Cell (2001) 8:1313-1325. DOI 10.1016/S1097-2765(01)00416-6 · PubMed

Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HEY 1.5 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5MZ7 1.53 Å, Crystal Structure of the third PDZ domain from the synaptic protein PSD-95 with…
1TP5 1.54 Å, Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
5HFD 1.6 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant)
5HFB 1.62 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant) in complex with a…
5HEB 1.65 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a C-terminal…
5HED 1.7 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a mutant…
5HF1 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5HFF 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
5HF4 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant)
1KJW 1.8 Å, SH3-Guanylate Kinase Module from PSD-95
5HFE 1.8 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…

Browse structure collections

About this viewer

MolViewer shows 1JXM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.