1JXQ: Cleaved, CARD domain deleted Caspase-9

Structure of cleaved, CARD domain deleted Caspase-9. Determined by X-ray diffraction at 2.8 Å resolution. Released 12 Dec 2001.

Method

X-ray diffraction

Resolution

2.8 Å

Organism

Homo sapiens

Chains

6

Atoms

7,596

Mol. weight

126.79 kDa

Released

12 Dec 2001

Explore 1JXQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JXQ contains 33 α-helices and 70 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Molecules and chains

>1JXQ_1 Caspase-9 (chains A, B, C, D)
MGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLH
FMVEVKGDLTAKKMVLALLELARQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPV
SVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATP
FQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSE
DLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTSHHHHHH

>1JXQ_2 benzoxycarbonyl-Val-Ala-Asp-fluoromethyl ketone Inhibitor (chains E, F)
XEVDX

Primary citation

Dimer formation drives the activation of the cell death protease caspase 9. Renatus, M., Stennicke, H.R., Scott, F.L. et al. Proc Natl Acad Sci U S A (2001) 98:14250-14255. DOI 10.1073/pnas.231465798 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P55211 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 3D9T 1.5 Å, CIAP1-BIR3 in complex with N-terminal peptide from Caspase-9 (ATPFQE)
• 4RHW 2.1 Å, Crystal structure of Apaf-1 CARD and caspase-9 CARD complex
• 1NW9 2.4 Å, Structure of caspase-9 in an inhibitory complex with xiap-BIR3
• 9R44 2.46 Å, Crystal structure of human caspase-9 CARD
• 3YGS 2.5 Å, Apaf-1 card in complex with prodomain of procaspase-9
• 2AR9 2.8 Å, Crystal structure of a dimeric caspase-9
• 5WVC 2.99 Å, Structure of the CARD-CARD disk
• 9S6F 3.3 Å, Cryo-EM structure of human caspase-9 CARD (WT) filament
• 3V3K 3.49 Å, Human caspase 9 in complex with bacterial effector protein
• 9S6E 3.5 Å, Cryo-EM structure of human caspase-9 CARD (H38R) mutant filament
• 5JUY 4.1 Å, Active human apoptosome with procaspase-9
• 5WVE 4.4 Å, Apaf-1-Caspase-9 holoenzyme

Browse structure collections

About this viewer

MolViewer shows 1JXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.