Human DNA topoisomerase I in covalent complex with a 22 base pair DNA duplex. Determined by X-ray diffraction at 3.2 Å resolution. Released 4 Dec 2002.
Explore 1K4S in 3D Show helices and sheets RCSB PDB PDBe
1K4S contains 25 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 205-207 | 3 | |
| β-strand | 220-221 | 2 | 1 |
| β-strand | 226 | 1 | 2 |
| α-helix | 227-231 | 5 | |
| α-helix | 233-235 | 3 | |
| α-helix | 251-261 | 11 | |
| α-helix | 267-270 | 4 | |
| α-helix | 272-284 | 13 | |
| α-helix | 288-293 | 6 | |
| α-helix | 303-316 | 14 | |
| α-helix | 321-338 | 18 | |
| β-strand | 340 | 1 | 3 |
| β-strand | 342-343 | 2 | 1 |
| β-strand | 346 | 1 | 1 |
| β-strand | 349 | 1 | 3 |
| β-strand | 350 | 1 | 4 |
| β-strand | 354 | 1 | 2 |
| α-helix | 355-358 | 4 | |
| β-strand | 360 | 1 | 5 |
| β-strand | 373 | 1 | 5 |
| α-helix | 379-381 | 3 | |
| β-strand | 383-385 | 3 | 6 |
| β-strand | 388 | 1 | 7 |
| β-strand | 390 | 1 | 7 |
| α-helix | 392-395 | 4 | |
| β-strand | 403-405 | 3 | 6 |
| β-strand | 414-417 | 4 | 6 |
| β-strand | 424-427 | 4 | 6 |
| β-strand | 429 | 1 | 4 |
| α-helix | 434-450 | 17 | |
| α-helix | 455-464 | 10 | |
| α-helix | 470-485 | 16 | |
| β-strand | 508 | 1 | 8 |
| α-helix | 509-511 | 3 | |
| β-strand | 512-518 | 7 | 9 |
| β-strand | 521-527 | 7 | 9 |
| β-strand | 530 | 1 | 10 |
| α-helix | 532-534 | 3 | |
| β-strand | 536 | 1 | 10 |
| β-strand | 539-542 | 4 | 9 |
| α-helix | 545-555 | 11 | |
| β-strand | 563 | 1 | 8 |
| α-helix | 570-580 | 11 | |
| α-helix | 586-604 | 19 | |
| α-helix | 612-630 | 19 | |
| α-helix | 719-722 | 4 | |
| α-helix | 726-736 | 11 | |
| α-helix | 740-742 | 3 | |
| α-helix | 746-751 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*(5IU)P*(5IU))-3' | B | DNA | 10 | ||
| 5'-D(*(SPT)P*GP*AP*AP*AP*AP*AP*(5IU)P*(5IU)P*(5IU)P*(5IU)P*T)-3' | C | DNA | 12 | ||
| 5'-d(*ap*ap*ap*ap*ap*tp*(ido)up*(ido)up*(ido)up*(ido)up*cp*ap*ap*ap*gp*(ido)up*cp*(ido)up*(ido)up*(… | D | DNA | 22 | ||
| DNA topoisomerase I | A | protein | 592 | Homo sapiens | P11387 (AlphaFold model) |
>1K4S_1 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*(5IU)P*(5IU))-3' (chains B) AAAAAGACUU
>1K4S_2 5'-D(*(SPT)P*GP*AP*AP*AP*AP*AP*(5IU)P*(5IU)P*(5IU)P*(5IU)P*T)-3' (chains C) TGAAAAAUUUUT
>1K4S_3 5'-D(*AP*AP*AP*AP*AP*TP*(IDO)UP*(IDO)UP*(IDO)UP*(IDO)UP*CP*AP*AP*AP*GP*(IDO)UP*CP*(IDO)UP*(IDO)UP*(IDO)UP*(IDO)UP*T)-3' (chains D) AAAAATUUUUCAAAGUCUUUUT
>1K4S_4 DNA topoisomerase I (chains A) KKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEP LPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNI ITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANF KIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWL VSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVR QRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKD SIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYN ASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDA KKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQ IALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
The mechanism of topoisomerase I poisoning by a camptothecin analog. Staker, B.L., Hjerrild, K., Feese, M.D. et al. Proc Natl Acad Sci U S A (2002) 99:15387-15392. DOI 10.1073/pnas.242259599 · PubMed
Other PDB entries of the same protein (UniProt P11387 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1K4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.