1KHU: SMAD1

Smad1 crystal structure reveals the details of BMP signaling pathway. Determined by X-ray diffraction at 2.5 Å resolution. Released 12 Dec 2001.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,772
Mol. weight: 98.18 kDa
Released: 12 Dec 2001

Explore 1KHU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KHU contains 32 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	272-278	7	1
β-strand	281-282	2	1
β-strand	287-288	2	1
β-strand	293-297	5	2
β-strand	308-310	3	2
α-helix	321-327	7
β-strand	334-338	5	2
β-strand	342-347	6	2
β-strand	353-356	4	1
α-helix	358-363	6
β-strand	372-374	3	1
β-strand	379-384	6	2
α-helix	385-393	9
α-helix	400-404	5
α-helix	405-410	6
β-strand	411-416	6	1
α-helix	429-431	3
β-strand	435-440	6	1
α-helix	441-451	11

Chain B: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	272-278	7	3
β-strand	281-282	2	3
α-helix	285-286	2
β-strand	287-288	2	3
β-strand	293-297	5	4
β-strand	308-310	3	4
α-helix	321-329	9
β-strand	334-339	6	4
β-strand	342-347	6	4
β-strand	353-356	4	3
α-helix	358-364	7
β-strand	371-374	4	3
β-strand	379-384	6	4
α-helix	385-395	11
α-helix	396-398	3
α-helix	400-404	5
α-helix	405-410	6
β-strand	411-416	6	3
β-strand	421	1	5
β-strand	427	1	5
α-helix	429-431	3
β-strand	435-440	6	3
α-helix	441-451	11

Chain C: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	272-278	7	6
β-strand	281-282	2	6
α-helix	285-286	2
β-strand	287-288	2	6
β-strand	293-296	4	7
β-strand	308	1	7
α-helix	321-327	7
β-strand	334-339	6	7
β-strand	342-347	6	7
β-strand	353-356	4	6
α-helix	358-364	7
β-strand	372-374	3	6
β-strand	379-384	6	7
α-helix	385-395	11
α-helix	400-405	6
α-helix	408-410	3
β-strand	411-416	6	6
α-helix	429-431	3
β-strand	435-440	6	6
α-helix	441-453	13

Chain D: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	272-278	7	8
β-strand	281-282	2	8
α-helix	285-286	2
β-strand	287-288	2	8
β-strand	293-297	5	9
β-strand	308-310	3	9
α-helix	321-327	7
β-strand	334-338	5	9
β-strand	342-347	6	9
β-strand	353-356	4	8
α-helix	358-364	7
β-strand	372-374	3	8
β-strand	379-384	6	9
α-helix	385-395	11
α-helix	401-404	4
α-helix	405-410	6
β-strand	411-416	6	8
α-helix	429-431	3
β-strand	435-440	6	8
α-helix	441-451	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SMAD1	A, B, C, D	protein	218	Homo sapiens	Q15797 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1KHU_1 SMAD1 (chains A, B, C, D)
APPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKN
RFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFH
PTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQ
DVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

Primary citation

Structural basis of Smad1 activation by receptor kinase phosphorylation. Qin, B.Y., Chacko, B.M., Lam, S.S. et al. Mol Cell (2001) 8:1303-1312. DOI 10.1016/S1097-2765(01)00417-8 · PubMed

Other PDB entries of the same protein (UniProt Q15797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q4A 1.54 Å, Crystal structure of the TPR domain of CHIP complexed with phosphorylated Smad1 peptide
3Q47 1.71 Å, Crystal structure of TPR domain of CHIP complexed with pseudophosphorylated Smad1 peptide
5ZOK 2.85 Å, Crystal structure of human SMAD1-MAN1 complex.
2LAW Structure of the second WW domain from human YAP in complex with a human Smad1 derived…
2LAX Structure of first WW domain of human YAP in complex with a human Smad1…
2LAY Structure of the first WW domain of human YAP in complex with a phosphorylated human…
2LAZ Structure of the first WW domain of human Smurf1 in complex with a mono-phosphorylated…
2LB0 Structure of the first WW domain of human Smurf1 in complex with a di-phosphorylated…
2LB1 Structure of the second domain of human Smurf1 in complex with a human Smad1 derived…

Browse structure collections

About this viewer

MolViewer shows 1KHU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.