5ZOK: Human SMAD1-MAN1 complex

Crystal structure of human SMAD1-MAN1 complex. Determined by X-ray diffraction at 2.85 Å resolution. Released 17 Oct 2018.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,213
Mol. weight: 77.24 kDa
Released: 17 Oct 2018

Explore 5ZOK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZOK contains 28 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	272-278	7	1
β-strand	281-288	8	1
β-strand	293-297	5	2
β-strand	308-310	3	2
α-helix	321-327	7
β-strand	334-339	6	2
β-strand	342-347	6	2
β-strand	353-356	4	1
α-helix	358-364	7
α-helix	370-371	2
β-strand	372-374	3	1
β-strand	379-384	6	2
α-helix	385-395	11
α-helix	396-398	3
α-helix	400-404	5
α-helix	405-410	6
β-strand	411-416	6	1
α-helix	429-431	3
β-strand	435-440	6	1
α-helix	441-451	11

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	765-768	4	3
α-helix	774-776	3
β-strand	785-788	4	4
α-helix	794-796	3
α-helix	802-813	12
β-strand	820-825	6	4
β-strand	834-838	5	4
α-helix	841-851	11
β-strand	854-856	3	3
β-strand	859-861	3	3
β-strand	863-865	3	4
α-helix	868-874	7
α-helix	876-879	4

Chain C: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	272-278	7	5
β-strand	281-288	8	5
β-strand	293-297	5	6
β-strand	308-310	3	6
α-helix	321-328	8
β-strand	334-339	6	6
β-strand	342-347	6	6
β-strand	353-357	5	5
α-helix	358-364	7
β-strand	372-374	3	5
β-strand	379-384	6	6
α-helix	385-395	11
α-helix	396-398	3
α-helix	400-404	5
α-helix	405-410	6
β-strand	411-416	6	5
α-helix	429-431	3
β-strand	435-440	6	5
α-helix	441-451	11

Chain D: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	765-768	4	7
β-strand	785-789	5	8
α-helix	794-796	3
α-helix	802-813	12
β-strand	820-825	6	8
β-strand	834-838	5	8
α-helix	841-851	11
β-strand	854-856	3	7
β-strand	859-860	2	7
β-strand	862-866	5	8
α-helix	868-874	7
α-helix	876-879	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mothers against decapentaplegic homolog 1	A, C	protein	209	Homo sapiens	Q15797 (AlphaFold model)
Inner nuclear membrane protein Man1	B, D	protein	132	Homo sapiens	Q9Y2U8 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5ZOK_1 Mothers against decapentaplegic homolog 1 (chains A, C)
GPDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSN
VNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPS
GCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWI
EIHLHGPLQWLDKVLTQMGSPHNPISEVE

Sequence of entity 2 (B, D), FASTA

>5ZOK_2 Inner nuclear membrane protein Man1 (chains B, D)
GPGSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDND
GIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA
LTSNTPLKPSNK

Primary citation

Structural basis for receptor-regulated SMAD recognition by MAN1. Miyazono, K.I., Ohno, Y., Wada, H. et al. Nucleic Acids Res (2018) 46:12139-12153. DOI 10.1093/nar/gky925 · PubMed

Other PDB entries of the same protein (UniProt Q15797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q4A 1.54 Å, Crystal structure of the TPR domain of CHIP complexed with phosphorylated Smad1 peptide
3Q47 1.71 Å, Crystal structure of TPR domain of CHIP complexed with pseudophosphorylated Smad1 peptide
1KHU 2.5 Å, Smad1 crystal structure reveals the details of BMP signaling pathway
2LAW Structure of the second WW domain from human YAP in complex with a human Smad1 derived…
2LAX Structure of first WW domain of human YAP in complex with a human Smad1…
2LAY Structure of the first WW domain of human YAP in complex with a phosphorylated human…
2LAZ Structure of the first WW domain of human Smurf1 in complex with a mono-phosphorylated…
2LB0 Structure of the first WW domain of human Smurf1 in complex with a di-phosphorylated…
2LB1 Structure of the second domain of human Smurf1 in complex with a human Smad1 derived…

Browse structure collections

About this viewer

MolViewer shows 5ZOK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.