Chromo domain of HP1 complexed with histone H3 tail containing trimethyllysine 9. Determined by X-ray diffraction at 2.4 Å resolution. Released 20 Mar 2002.
Explore 1KNE in 3D Show helices and sheets RCSB PDB PDBe
1KNE contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 24-25 | 2 | 1 |
| β-strand | 26-35 | 10 | 2 |
| β-strand | 38-45 | 8 | 2 |
| α-helix | 50-52 | 3 | |
| β-strand | 54-57 | 4 | 2 |
| α-helix | 58-60 | 3 | |
| β-strand | 61-62 | 2 | 1 |
| α-helix | 64-70 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-7 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heterochromatin protein 1 | A | protein | 69 | Drosophila melanogaster | P05205 (AlphaFold model) |
| Trimethylated Histone H3 | P | protein | 16 | P02299 (AlphaFold model) |
>1KNE_1 HETEROCHROMATIN PROTEIN 1 (chains A) MKKHHHHHHAEEEEEEYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLI QQYEASRKD
>1KNE_2 Trimethylated Histone H3 (chains P) ARTKQTARKSTGGKAY
Structure of HP1 chromodomain bound to a lysine 9-methylated histone H3 tail. Jacobs, S.A., Khorasanizadeh, S. Science (2002) 295:2080-2083. DOI 10.1126/science.1069473 · PubMed
Other PDB entries of the same protein (UniProt P05205 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1KNE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.