1KOH: Tip associating protein

The crystal structure and mutational analysis of a novel RNA-binding domain found in the human tap nuclear mRNA export factor. Determined by X-ray diffraction at 3.8 Å resolution. Released 27 Feb 2002.

Method: X-ray diffraction
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,854
Mol. weight: 125.93 kDa
Released: 27 Feb 2002

Explore 1KOH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KOH contains 37 α-helices and 35 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	119-121	3	1
β-strand	124	1	2
α-helix	132-141	10
β-strand	150	1	1
β-strand	154-155	2	2
β-strand	158-159	2	2
β-strand	162-163	2	1
α-helix	166-170	5
α-helix	173-175	3
β-strand	192-194	3	1
α-helix	206-217	12
β-strand	220	1	3
β-strand	227	1	3
α-helix	250-263	14
α-helix	282-284	3
α-helix	286-289	4
α-helix	306-308	3
α-helix	309-312	4
α-helix	334-342	9
β-strand	350-351	2	4
β-strand	354-355	2	4

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	206-218	13
α-helix	222-224	3
β-strand	226	1	5
α-helix	236-239	4
α-helix	250-261	12
β-strand	269-270	2	5
α-helix	280-283	4
α-helix	286-289	4
β-strand	295-297	3	5
β-strand	319-321	3	5
α-helix	326-329	4
α-helix	334-344	11
β-strand	350-351	2	5
β-strand	354-355	2	5
α-helix	357-359	3

Chain C: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	122	1	6
α-helix	133-137	5
α-helix	138-139	2
β-strand	154-155	2	7
β-strand	158-159	2	7
β-strand	161	1	6
α-helix	169-172	4
β-strand	191	1	6
α-helix	206-218	13
α-helix	250-263	14
β-strand	269-271	3	8
α-helix	286-289	4
β-strand	295-297	3	8
α-helix	312-314	3
β-strand	320	1	9
α-helix	327-330	4
α-helix	334-342	9
β-strand	350-351	2	9
β-strand	354-355	2	9
α-helix	356-357	2

Chain D: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	206-218	13
β-strand	226-228	3	10
α-helix	238-240	3
α-helix	254-262	9
β-strand	269-271	3	10
α-helix	281-283	3
α-helix	286-289	4
β-strand	295-297	3	10
α-helix	307-310	4
β-strand	319-321	3	10
β-strand	323	1	11
β-strand	325	1	11
α-helix	334-344	11
β-strand	350-351	2	10
β-strand	354-355	2	10
α-helix	356-358	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tip associating protein	A, B, C, D	protein	277	Homo sapiens	Q9UBU9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1KOH_1 TIP ASSOCIATING PROTEIN (chains A, B, C, D)
VRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKSSVPFTPIEFHYE
NTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLI
MSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSSMAATLRIIEENIPELLSLNLSNN
RLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLSDTFRDQS
TYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPP

Primary citation

The crystal structure and mutational analysis of a novel RNA-binding domain found in the human Tap nuclear mRNA export factor. Ho, D.N., Coburn, G.A., Kang, Y. et al. Proc Natl Acad Sci U S A (2002) 99:1888-1893. DOI 10.1073/pnas.042698599 · PubMed

Other PDB entries of the same protein (UniProt Q9UBU9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OAI 1.0 Å, Complex between Tap UBA domain and FxFG nucleoporin peptide
9I8A 1.5 Å, NXT1-NXF1 complex crystallized in space group P65 2 2
1JKG 1.9 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
3RW6 2.3 Å, Structure of nuclear RNA export factor TAP bound to CTE RNA
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
1JN5 2.8 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
1FO1 2.9 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
3RW7 3.0 Å, Structure of N-terminal domain of nuclear RNA export factor TAP
1FT8 3.15 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
4WYK 3.4 Å, Structure of the LRR and NTF2-like domains of NXF1 complexed with NXT1
1KOO 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…

Browse structure collections

About this viewer

MolViewer shows 1KOH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.