Cathepsin-G. Determined by X-ray diffraction at 3.5 Å resolution. Released 1 May 2002.
Explore 1KYN in 3D Show helices and sheets RCSB PDB PDBe
1KYN contains 16 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30 | 1 | 3 |
| β-strand | 32 | 1 | 4 |
| β-strand | 33 | 1 | 5 |
| β-strand | 42 | 1 | 5 |
| β-strand | 45-46 | 2 | 3 |
| β-strand | 51-54 | 4 | 3 |
| β-strand | 65-68 | 4 | 4 |
| β-strand | 72 | 1 | 6 |
| β-strand | 81-84 | 4 | 4 |
| β-strand | 85-90 | 6 | 3 |
| β-strand | 104-108 | 5 | 3 |
| β-strand | 115 | 1 | 7 |
| β-strand | 118 | 1 | 7 |
| α-helix | 122-125 | 4 | |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 154 | 1 | 6 |
| β-strand | 156-161 | 6 | 2 |
| α-helix | 162-164 | 3 | |
| α-helix | 165-169 | 5 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-200 | 3 | 2 |
| β-strand | 209-216 | 8 | 2 |
| α-helix | 221 | 1 | |
| α-helix | 225 | 1 | |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-233 | 3 | |
| α-helix | 235-242 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 317 | 1 | 8 |
| β-strand | 320-321 | 2 | 9 |
| α-helix | 322-323 | 2 | |
| β-strand | 330 | 1 | 10 |
| β-strand | 332 | 1 | 11 |
| β-strand | 333 | 1 | 12 |
| β-strand | 342 | 1 | 12 |
| β-strand | 345-346 | 2 | 10 |
| β-strand | 351-354 | 4 | 10 |
| β-strand | 365-368 | 4 | 11 |
| β-strand | 372 | 1 | 13 |
| β-strand | 381-384 | 4 | 11 |
| β-strand | 385-390 | 6 | 10 |
| β-strand | 404-408 | 5 | 10 |
| β-strand | 415 | 1 | 14 |
| β-strand | 418 | 1 | 14 |
| α-helix | 422-425 | 4 | |
| β-strand | 435-440 | 6 | 9 |
| β-strand | 454 | 1 | 13 |
| β-strand | 456-461 | 6 | 9 |
| α-helix | 462-464 | 3 | |
| α-helix | 465-469 | 5 | |
| β-strand | 480-483 | 4 | 9 |
| β-strand | 489 | 1 | 8 |
| β-strand | 498-500 | 3 | 9 |
| β-strand | 509-516 | 8 | 9 |
| α-helix | 521 | 1 | |
| α-helix | 525 | 1 | |
| β-strand | 526-530 | 5 | 9 |
| α-helix | 531-533 | 3 | |
| α-helix | 535-542 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cathepsin G | A, B | protein | 235 | Homo sapiens | P08311 (AlphaFold model) |
>1KYN_1 cathepsin G (chains A, B) IIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQ RRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGT LCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGD SGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL
| ID | Name | Formula | Copies |
|---|---|---|---|
| KTP | (2-naphthalen-2-yl-1-naphthalen-1-yl-2-oxo-ethyl)-phosphonic acid | C22 H17 O4 P | 2 |
Nonpeptide inhibitors of cathepsin G: optimization of a novel beta-ketophosphonic acid lead by structure-based drug design. Greco, M.N., Hawkins, M.J., Powell, E.T. et al. J Am Chem Soc (2002) 124:3810-3811. DOI 10.1021/ja017506h · PubMed
Other PDB entries of the same protein (UniProt P08311 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1KYN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.