1KZ7: DH/PH Fragment of Murine Dbs

Crystal Structure of the DH/PH Fragment of Murine Dbs in Complex with the Placental Isoform of Human Cdc42. Determined by X-ray diffraction at 2.4 Å resolution. Released 20 Mar 2002.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 8,598
Mol. weight: 125.3 kDa
Released: 20 Mar 2002

Explore 1KZ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KZ7 contains 59 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	625-654	30
α-helix	655-659	5
α-helix	660-663	4
α-helix	673-677	5
α-helix	679-683	5
α-helix	686-692	7
α-helix	693-697	5
α-helix	698-702	5
α-helix	708-710	3
α-helix	711-716	6
α-helix	721-723	3
α-helix	724-742	19
α-helix	746-755	10
α-helix	761-765	5
α-helix	767-784	18
α-helix	792-815	24
β-strand	818-819	2	1
α-helix	825-828	4
β-strand	831-841	11	1
α-helix	843-845	3
β-strand	859-866	8	1
β-strand	869-876	8	1
β-strand	888-896	9	1
α-helix	897-899	3
β-strand	900-903	4	1
β-strand	906	1	2
β-strand	909	1	2
β-strand	912-917	6	1
β-strand	922-927	6	1
α-helix	931-958	28

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	3
α-helix	16-25	10
β-strand	40-46	7	3
β-strand	49-56	8	3
α-helix	68-71	4
β-strand	77-83	7	3
α-helix	87-92	6
α-helix	93-97	5
α-helix	98-104	7
β-strand	110-115	6	3
α-helix	117-121	5
α-helix	123-130	8
α-helix	136-138	3
α-helix	139-148	10
β-strand	154-156	3	3
α-helix	165-177	13

Chain C: 20 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	1625-1654	30
α-helix	1655-1659	5
α-helix	1660-1663	4
α-helix	1665-1670	6
α-helix	1673-1676	4
α-helix	1679-1683	5
α-helix	1686-1692	7
α-helix	1693-1697	5
α-helix	1698-1702	5
α-helix	1708-1710	3
α-helix	1711-1717	7
α-helix	1720-1723	4
α-helix	1724-1742	19
α-helix	1746-1755	10
α-helix	1761-1765	5
α-helix	1767-1784	18
α-helix	1792-1815	24
β-strand	1818-1819	2	4
α-helix	1825-1828	4
β-strand	1831-1841	11	4
β-strand	1859-1866	8	4
β-strand	1869-1876	8	4
β-strand	1888-1896	9	4
α-helix	1897-1899	3
β-strand	1900-1903	4	4
β-strand	1912-1917	6	4
β-strand	1922-1927	6	4
α-helix	1931-1955	25

Chain D: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1003-1010	8	5
α-helix	1016-1025	10
β-strand	1040-1046	7	5
β-strand	1049-1056	8	5
α-helix	1068-1071	4
β-strand	1077-1083	7	5
α-helix	1087-1092	6
α-helix	1093-1097	5
α-helix	1098-1104	7
β-strand	1110-1115	6	5
α-helix	1117-1119	3
α-helix	1123-1130	8
α-helix	1139-1148	10
β-strand	1154-1156	3	5
α-helix	1165-1176	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide exchange factor dbs	A, C	protein	353	Mus musculus	Q64096 (AlphaFold model)
CDC42 homolog	B, D	protein	188	Homo sapiens	P60953 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1KZ7_1 GUANINE NUCLEOTIDE EXCHANGE FACTOR DBS (chains A, C)
MGEEEESLAILRRHVMNELLDTERAYVEELLCVLEGYAAEMDNPLMAHLISTGLQNKKNI
LFGNMEEIYHFHNRIFLRELESCIDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQ
CSDCPFFQECQKKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKHCEGAEDLQEALSS
ILGILKAVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQR
HLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMTAVGITENVKGDTKKFEIWYNARE
EVYIIQAPTPEIKAAWVNAIRKVLTSQLQACREASQHRALEQSHSLEHHHHHH

Sequence of entity 2 (B, D), FASTA

>1KZ7_2 CDC42 HOMOLOG (chains B, D)
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRS

Primary citation

A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange. Rossman, K.L., Worthylake, D.K., Snyder, J.T. et al. EMBO J (2002) 21:1315-1326. DOI 10.1093/emboj/21.6.1315 · PubMed

Other PDB entries of the same protein (UniProt Q64096 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KZG 2.6 Å, DbsCdc42(Y889F)
1LB1 2.81 Å, Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA
1RJ2 3.0 Å, Crystal structure of the DH/PH fragment of Dbs without bound GTPase

Browse structure collections

About this viewer

MolViewer shows 1KZ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.