1KZG: DbsCdc42(Y889F)

DbsCdc42(Y889F). Determined by X-ray diffraction at 2.6 Å resolution. Released 20 Mar 2002.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 8,396
Mol. weight: 124.36 kDa
Released: 20 Mar 2002

Explore 1KZG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KZG contains 61 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	625-654	30
α-helix	655-659	5
α-helix	660-662	3
α-helix	665-667	3
α-helix	673-676	4
α-helix	679-683	5
α-helix	686-691	6
α-helix	692-697	6
α-helix	698-702	5
α-helix	708-710	3
α-helix	711-717	7
α-helix	721-723	3
α-helix	724-742	19
α-helix	746-755	10
α-helix	761-772	12
α-helix	775-784	10
α-helix	792-815	24
β-strand	818-819	2	1
α-helix	825-828	4
β-strand	831-841	11	1
β-strand	859-866	8	1
β-strand	869-876	8	1
β-strand	888-896	9	1
α-helix	897-899	3
β-strand	900-903	4	1
β-strand	906	1	2
β-strand	909	1	2
β-strand	912-917	6	1
β-strand	922-927	6	1
α-helix	931-960	30

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	3
α-helix	16-25	10
β-strand	40-46	7	3
β-strand	49-56	8	3
α-helix	68-71	4
β-strand	77-83	7	3
α-helix	87-92	6
α-helix	93-97	5
α-helix	98-104	7
β-strand	110-115	6	3
α-helix	117-120	4
α-helix	123-130	8
α-helix	136-138	3
α-helix	139-149	11
β-strand	154-156	3	3
α-helix	165-176	12

Chain C: 21 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	1625-1654	30
α-helix	1655-1659	5
α-helix	1660-1662	3
α-helix	1673-1676	4
α-helix	1679-1683	5
α-helix	1686-1691	6
α-helix	1692-1697	6
α-helix	1698-1702	5
α-helix	1708-1710	3
α-helix	1711-1716	6
α-helix	1721-1723	3
α-helix	1724-1742	19
α-helix	1746-1755	10
α-helix	1761-1765	5
α-helix	1767-1772	6
α-helix	1775-1784	10
α-helix	1792-1815	24
β-strand	1818-1819	2	4
α-helix	1825-1828	4
β-strand	1831-1841	11	4
β-strand	1859-1866	8	4
β-strand	1869-1874	6	4
β-strand	1889-1896	8	4
α-helix	1897-1899	3
β-strand	1900-1903	4	4
β-strand	1906	1	5
β-strand	1909	1	5
β-strand	1912-1917	6	4
α-helix	1918-1920	3
β-strand	1922-1927	6	4
α-helix	1931-1954	24

Chain D: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1004-1010	7	6
α-helix	1016-1025	10
β-strand	1040-1046	7	6
β-strand	1049-1056	8	6
α-helix	1068-1071	4
β-strand	1077-1083	7	6
α-helix	1087-1092	6
α-helix	1093-1097	5
α-helix	1098-1104	7
β-strand	1110-1115	6	6
α-helix	1117-1119	3
α-helix	1123-1130	8
α-helix	1136-1138	3
α-helix	1139-1149	11
β-strand	1153-1156	4	6
α-helix	1165-1176	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide exchange factor dbs	A, C	protein	353	Mus musculus	Q64096 (AlphaFold model)
CDC42 homolog	B, D	protein	188	Homo sapiens	P60953 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1KZG_1 GUANINE NUCLEOTIDE EXCHANGE FACTOR DBS (chains A, C)
MGEEEESLAILRRHVMNELLDTERAYVEELLCVLEGYAAEMDNPLMAHLISTGLQNKKNI
LFGNMEEIYHFHNRIFLRELESCIDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQ
CSDCPFFQECQKKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKHCEGAEDLQEALSS
ILGILKAVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQR
HLFLHEKAVLFCKKREENGEGYEKAPSFSYKQSLNMTAVGITENVKGDTKKFEIWYNARE
EVYIIQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSHSLEHHHHHH

Sequence of entity 2 (B, D), FASTA

>1KZG_2 CDC42 HOMOLOG (chains B, D)
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRS

Primary citation

A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange. Rossman, K.L., Worthylake, D.K., Snyder, J.T. et al. EMBO J (2002) 21:1315-1326. DOI 10.1093/emboj/21.6.1315 · PubMed

Other PDB entries of the same protein (UniProt Q64096 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KZ7 2.4 Å, Crystal Structure of the DH/PH Fragment of Murine Dbs in Complex with the Placental…
1LB1 2.81 Å, Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA
1RJ2 3.0 Å, Crystal structure of the DH/PH fragment of Dbs without bound GTPase

Browse structure collections

About this viewer

MolViewer shows 1KZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.