1L2Z: CD2BP2-GYF domain

CD2BP2-GYF domain in complex with proline-rich CD2 tail segment peptide. Determined by solution NMR. Released 20 Nov 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 606
Mol. weight: 8.56 kDa
Released: 20 Nov 2002

Explore 1L2Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1L2Z contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	5-7	3	2
β-strand	17	1	2
β-strand	21	1	1
α-helix	22-31	10
β-strand	39-41	3	2
β-strand	51-52	2	2
α-helix	53-55	3
α-helix	58-60	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	66-68	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD2 antigen (cytoplasmic tail)-binding protein 2	A	protein	62	Homo sapiens	O95400 (AlphaFold model)
T-cell surface antigen CD2	B	protein	11		P06729 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1L2Z_1 CD2 ANTIGEN (CYTOPLASMIC TAIL)-BINDING PROTEIN 2 (chains A)
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDL
YT

Sequence of entity 2 (B), FASTA

>1L2Z_2 T-CELL SURFACE ANTIGEN CD2 (chains B)
SHRPPPPGHRV

Primary citation

Dynamic interaction of CD2 with the GYF and the SH3 domain of compartmentalized effector molecules. Freund, C., Kuhne, R., Yang, H. et al. EMBO J (2002) 21:5985-5995. DOI 10.1093/emboj/cdf602 · PubMed

Other PDB entries of the same protein (UniProt O95400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SYX 2.35 Å, The crystal structure of a binary U5 snRNP complex
4BWS 2.5 Å, Crystal structure of the heterotrimer of PQBP1, U5-15kD and U5-52kD.
8Q91 3.1 Å, Structure of the human 20S U5 snRNP core
8Q7Q 3.2 Å, Structure of the recycling U5 snRNP bound to chaperones CD2BP2 and TSSC4 (State 2)
8RC0 3.2 Å, Structure of the human 20S U5 snRNP
8Q7V 3.8 Å, Structure of the recycling U5 snRNP bound to chaperones CD2BP2 and TSSC4 (State 1)
8Q7W 3.9 Å, Structure of the recycling U5 snRNP bound to chaperone CD2BP2 (State 3)
8Q7X 4.6 Å, Structure of the recycling U5 snRNP bound to chaperone CD2BP2 (State 4)
1GYF Gyf domain from human CD2BP2 protein

Browse structure collections

About this viewer

MolViewer shows 1L2Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.