1LAU: Uracil-DNA glycosylase

Uracil-DNA glycosylase. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 Jun 1996.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Human herpesvirus 1
Chains: 2
Atoms: 2,048
Mol. weight: 28.23 kDa
Released: 10 Jun 1996

Explore 1LAU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LAU contains 16 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 16 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	18-26	9
α-helix	30-32	3
α-helix	33-36	4
α-helix	37-41	5
α-helix	43-58	16
β-strand	61-62	2	1
α-helix	65-67	3
α-helix	70-72	3
α-helix	77-79	3
β-strand	82-86	5	2
α-helix	108-110	3
α-helix	111-123	13
α-helix	136-140	5
β-strand	143-147	5	2
β-strand	152-153	2	1
β-strand	156	1	1
α-helix	165-179	15
β-strand	184-188	5	2
α-helix	190-195	6
β-strand	204-208	5	2
α-helix	219-221	3
α-helix	224-234	11
α-helix	237-240	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(tptp*t)-3')	D	DNA	3
Protein (uracil-DNA glycosylase (E.C.3.2.2.-))	E	protein	244	Human herpesvirus 1	P10186

Sequence of entity 1 (D), FASTA

>1LAU_1 DNA (5'-D(*TP*TP*T)-3') (chains D)
TTT

Sequence of entity 2 (E), FASTA

>1LAU_2 PROTEIN (URACIL-DNA GLYCOSYLASE (E.C.3.2.2.-)) (chains E)
MDLTNGGVSPAATSAPLDWTTFRRVFLIDDAWRPLMEPELANPLTAHLLAEYNRRCQTEE
VLPPREDVFSWTRYCTPDEVRVVIIGQDPYHHPGQAHGLAFSVRANVPPPPSLRNVLAAV
KNCYPEARMSGHGCLEKWARDGVLLLNTTLTVKRGAAASHSRIGWDRFVGGVIRRLAARR
PGLVFMLWGTHAQNAIRPDPRVHCVLKFSHPSPLSKVPFGTCQHFLVANRYLETRSISPI
DWSV

Primary citation

The structural basis of specific base-excision repair by uracil-DNA glycosylase. Savva, R., McAuley-Hecht, K., Brown, T. et al. Nature (1995) 373:487-493. DOI 10.1038/373487a0 · PubMed

Other PDB entries of the same protein (UniProt P10186), best resolution first:

1UDG 1.75 Å, The structural basis of specific base excision repair by uracil-DNA glycosylase
1UDH 1.75 Å, The structural basis of specific base excision repair by uracil-DNA glycosylase
2C53 1.8 Å, A comparative study of uracil DNA glycosylases from human and herpes simplex virus type 1
5AYS 2.09 Å, Crystal structure of SAUGI/HSV UDG complex
2C56 2.1 Å, A comparative study of uracil DNA glycosylases from human and herpes simplex virus type 1
4L5N 2.16 Å, Crystallographic Structure of HHV-1 Uracil-DNA Glycosylase complexed with the Bacillus…
1UDI 2.7 Å, Nucleotide mimicry in the crystal structure of the uracil-DNA glycosylase-uracil…

Browse structure collections

About this viewer

MolViewer shows 1LAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.