Uracil-DNA glycosylase. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 Jun 1996.
Explore 1LAU in 3D Show helices and sheets RCSB PDB PDBe
1LAU contains 16 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-26 | 9 | |
| α-helix | 30-32 | 3 | |
| α-helix | 33-36 | 4 | |
| α-helix | 37-41 | 5 | |
| α-helix | 43-58 | 16 | |
| β-strand | 61-62 | 2 | 1 |
| α-helix | 65-67 | 3 | |
| α-helix | 70-72 | 3 | |
| α-helix | 77-79 | 3 | |
| β-strand | 82-86 | 5 | 2 |
| α-helix | 108-110 | 3 | |
| α-helix | 111-123 | 13 | |
| α-helix | 136-140 | 5 | |
| β-strand | 143-147 | 5 | 2 |
| β-strand | 152-153 | 2 | 1 |
| β-strand | 156 | 1 | 1 |
| α-helix | 165-179 | 15 | |
| β-strand | 184-188 | 5 | 2 |
| α-helix | 190-195 | 6 | |
| β-strand | 204-208 | 5 | 2 |
| α-helix | 219-221 | 3 | |
| α-helix | 224-234 | 11 | |
| α-helix | 237-240 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (5'-d(*tp*tp*t)-3') | D | DNA | 3 | ||
| Protein (uracil-DNA glycosylase (E.C.3.2.2.-)) | E | protein | 244 | Human herpesvirus 1 | P10186 |
>1LAU_1 DNA (5'-D(*TP*TP*T)-3') (chains D) TTT
>1LAU_2 PROTEIN (URACIL-DNA GLYCOSYLASE (E.C.3.2.2.-)) (chains E) MDLTNGGVSPAATSAPLDWTTFRRVFLIDDAWRPLMEPELANPLTAHLLAEYNRRCQTEE VLPPREDVFSWTRYCTPDEVRVVIIGQDPYHHPGQAHGLAFSVRANVPPPPSLRNVLAAV KNCYPEARMSGHGCLEKWARDGVLLLNTTLTVKRGAAASHSRIGWDRFVGGVIRRLAARR PGLVFMLWGTHAQNAIRPDPRVHCVLKFSHPSPLSKVPFGTCQHFLVANRYLETRSISPI DWSV
The structural basis of specific base-excision repair by uracil-DNA glycosylase. Savva, R., McAuley-Hecht, K., Brown, T. et al. Nature (1995) 373:487-493. DOI 10.1038/373487a0 · PubMed
Other PDB entries of the same protein (UniProt P10186), best resolution first:
MolViewer shows 1LAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.